BLASTX nr result
ID: Papaver23_contig00020741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00020741 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283706.1| PREDICTED: dof zinc finger protein DOF5.2-li... 65 7e-09 ref|XP_003527086.1| PREDICTED: dof zinc finger protein DOF3.3-li... 62 6e-08 ref|XP_003523017.1| PREDICTED: dof zinc finger protein DOF3.3-li... 62 6e-08 gb|ADO61278.1| cycling DOF factor-like 1 [Helianthus annuus] 62 6e-08 gb|ADO61267.1| cycling DOF factor-like 1 [Helianthus annuus] 62 6e-08 >ref|XP_002283706.1| PREDICTED: dof zinc finger protein DOF5.2-like [Vitis vinifera] Length = 511 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 481 GGSLFKAFQSKTSEKSHVTESSQVLQANPAALSRSLNFQEIS 356 GG LFK+FQSK EK+H+ E+S VLQANPAALSRSLNF E S Sbjct: 470 GGRLFKSFQSKADEKNHIAETSPVLQANPAALSRSLNFHESS 511 >ref|XP_003527086.1| PREDICTED: dof zinc finger protein DOF3.3-like [Glycine max] Length = 458 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 481 GGSLFKAFQSKTSEKSHVTESSQVLQANPAALSRSLNFQEIS 356 GG +FK FQSK EK HV E+S VL+ANPAALSRSLNF E S Sbjct: 417 GGGMFKGFQSKKEEKDHVVEASPVLRANPAALSRSLNFHENS 458 >ref|XP_003523017.1| PREDICTED: dof zinc finger protein DOF3.3-like [Glycine max] Length = 450 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 481 GGSLFKAFQSKTSEKSHVTESSQVLQANPAALSRSLNFQEIS 356 GG +FK FQSK EK HV E+S VL+ANPAALSRSLNF E S Sbjct: 409 GGGMFKGFQSKKDEKDHVVEASPVLRANPAALSRSLNFHENS 450 >gb|ADO61278.1| cycling DOF factor-like 1 [Helianthus annuus] Length = 258 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 481 GGSLFKAFQSKTSEKSHVTESSQVLQANPAALSRSLNFQEIS 356 GG +FKAFQSK+ +KS + E+S LQANPAALSRSLNFQE S Sbjct: 217 GGGVFKAFQSKSEDKSPIKEASPALQANPAALSRSLNFQESS 258 >gb|ADO61267.1| cycling DOF factor-like 1 [Helianthus annuus] Length = 258 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 481 GGSLFKAFQSKTSEKSHVTESSQVLQANPAALSRSLNFQEIS 356 GG +FKAFQSK+ +KS + E+S LQANPAALSRSLNFQE S Sbjct: 217 GGGVFKAFQSKSEDKSPIKEASPALQANPAALSRSLNFQESS 258