BLASTX nr result
ID: Papaver23_contig00020609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00020609 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACK57305.1| plastid acetyl-CoA carboxylase [Leymus alaicus] 72 2e-14 ref|XP_003638794.1| Acetyl-CoA carboxylase [Medicago truncatula]... 72 4e-14 ref|XP_002446178.1| hypothetical protein SORBIDRAFT_06g003090 [S... 67 2e-13 gb|ABZ79247.1| plastid acetyl-CoA carboxylase, partial [Triticum... 68 2e-13 ref|XP_002302277.1| predicted protein [Populus trichocarpa] gi|2... 72 2e-13 >gb|ACK57305.1| plastid acetyl-CoA carboxylase [Leymus alaicus] Length = 232 Score = 72.0 bits (175), Expect(2) = 2e-14 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 259 EVQELCFKSKPNAWAYFSVKSGGGIHEFSDSQFGYV 366 +V+E+CFKSKPN WAYFSVKSGGGIHEF+DSQFG+V Sbjct: 183 KVKEICFKSKPNVWAYFSVKSGGGIHEFADSQFGHV 218 Score = 31.6 bits (70), Expect(2) = 2e-14 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 221 TRDPDGGFKPTGGKCRNCVLKA 286 + DPD GFKPTGGK + K+ Sbjct: 170 SEDPDDGFKPTGGKVKEICFKS 191 >ref|XP_003638794.1| Acetyl-CoA carboxylase [Medicago truncatula] gi|355504729|gb|AES85932.1| Acetyl-CoA carboxylase [Medicago truncatula] Length = 2256 Score = 71.6 bits (174), Expect(2) = 4e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 259 EVQELCFKSKPNAWAYFSVKSGGGIHEFSDSQFGYV 366 +VQEL FKSKPN WAYFSVKSGGGIHEFSDSQFG+V Sbjct: 452 KVQELSFKSKPNVWAYFSVKSGGGIHEFSDSQFGHV 487 Score = 30.8 bits (68), Expect(2) = 4e-14 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 221 TRDPDGGFKPTGGKCRNCVLKA 286 + DPD GFKPTGGK + K+ Sbjct: 439 SEDPDDGFKPTGGKVQELSFKS 460 >ref|XP_002446178.1| hypothetical protein SORBIDRAFT_06g003090 [Sorghum bicolor] gi|241937361|gb|EES10506.1| hypothetical protein SORBIDRAFT_06g003090 [Sorghum bicolor] Length = 2326 Score = 67.4 bits (163), Expect(2) = 2e-13 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +1 Query: 259 EVQELCFKSKPNAWAYFSVKSGGGIHEFSDSQFGYV--HNLRRS 384 +V+E+ FK+KPN WAYFSVKSGGGIHEF+DSQFG+V + L RS Sbjct: 545 KVKEITFKAKPNVWAYFSVKSGGGIHEFADSQFGHVFAYGLSRS 588 Score = 33.1 bits (74), Expect(2) = 2e-13 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 221 TRDPDGGFKPTGGKCRNCVLKA 286 + DPD GFKPTGGK + KA Sbjct: 532 SEDPDDGFKPTGGKVKEITFKA 553 >gb|ABZ79247.1| plastid acetyl-CoA carboxylase, partial [Triticum durum] Length = 232 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 259 EVQELCFKSKPNAWAYFSVKSGGGIHEFSDSQFGYV 366 +V+E+ FKSKPN WAYFSVKSGGGIHEF+DSQFG+V Sbjct: 183 KVREISFKSKPNVWAYFSVKSGGGIHEFADSQFGHV 218 Score = 32.3 bits (72), Expect(2) = 2e-13 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 221 TRDPDGGFKPTGGKCRNCVLKA 286 + DPD GFKPTGGK R K+ Sbjct: 170 SEDPDDGFKPTGGKVREISFKS 191 >ref|XP_002302277.1| predicted protein [Populus trichocarpa] gi|222844003|gb|EEE81550.1| predicted protein [Populus trichocarpa] Length = 2276 Score = 71.6 bits (174), Expect(2) = 2e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 259 EVQELCFKSKPNAWAYFSVKSGGGIHEFSDSQFGYV 366 +VQEL FKSKPN WAYFSVKSGGGIHEFSDSQFG+V Sbjct: 462 KVQELSFKSKPNVWAYFSVKSGGGIHEFSDSQFGHV 497 Score = 28.5 bits (62), Expect(2) = 2e-13 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 221 TRDPDGGFKPTGGKCRNCVLKA 286 + DPD GFKPT GK + K+ Sbjct: 449 SEDPDDGFKPTSGKVQELSFKS 470