BLASTX nr result
ID: Papaver23_contig00020557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00020557 (654 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containi... 42 7e-07 >ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Vitis vinifera] Length = 667 Score = 41.6 bits (96), Expect(2) = 7e-07 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = -2 Query: 149 YEDFLILFKEM-ECLGLRFDGVTVVSFLVAFAQLKYLDLGRKVHQLVVK 6 YED L+++M + GLR +GVTVVS L A AQ L G KVHQ +++ Sbjct: 221 YEDCKELYRKMLDSTGLRPNGVTVVSVLQACAQTNDLVFGMKVHQFIIE 269 Score = 37.4 bits (85), Expect(2) = 7e-07 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -3 Query: 274 ESDLLVINGLTTCYAQSRELRLVN-LFDQVQERDIVSW 164 +SD+ V+N L T Y++ E + LFD++ +RDIVSW Sbjct: 171 DSDIFVVNALITYYSRCDEYGIARILFDRMHDRDIVSW 208