BLASTX nr result
ID: Papaver23_contig00019516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00019516 (652 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272758.2| PREDICTED: DUF246 domain-containing protein ... 73 4e-11 emb|CAN77312.1| hypothetical protein VITISV_026198 [Vitis vinifera] 73 4e-11 ref|XP_003522604.1| PREDICTED: DUF246 domain-containing protein ... 61 2e-07 ref|XP_003526401.1| PREDICTED: DUF246 domain-containing protein ... 60 3e-07 ref|XP_003598018.1| DUF246 domain-containing protein [Medicago t... 57 2e-06 >ref|XP_002272758.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 582 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = +1 Query: 493 LENFIERIVYIFLSAVFRRRGVLLFAPIFYFSGMLMYMDSLSLLPGSRIGGGG 651 L +F+ER++++F+SAVFRRRG+LLFAP+ Y SGML+YM SLS G GGGG Sbjct: 54 LHSFVERVMFVFVSAVFRRRGLLLFAPVLYISGMLLYMGSLSFDGGGGGGGGG 106 >emb|CAN77312.1| hypothetical protein VITISV_026198 [Vitis vinifera] Length = 312 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = +1 Query: 493 LENFIERIVYIFLSAVFRRRGVLLFAPIFYFSGMLMYMDSLSLLPGSRIGGGG 651 L +F+ER++++F+SAVFRRRG+LLFAP+ Y SGML+YM SLS G GGGG Sbjct: 54 LHSFVERVMFVFVSAVFRRRGLLLFAPVLYISGMLLYMGSLSFDGGGGGGGGG 106 >ref|XP_003522604.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 683 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 499 NFIERIVYIFLSAVFRRRGVLLFAPIFYFSGMLMYMDSLSL 621 N +E++V+I +SAVFRRRG+LLFAP+ Y SGML+YM SLS+ Sbjct: 154 NSMEKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSI 194 >ref|XP_003526401.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 566 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +1 Query: 499 NFIERIVYIFLSAVFRRRGVLLFAPIFYFSGMLMYMDSLS 618 N +E++V+I +SAVFRRRG+LLFAP+ Y SGML+YM SLS Sbjct: 37 NSMEKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLS 76 >ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula] gi|355487066|gb|AES68269.1| DUF246 domain-containing protein [Medicago truncatula] Length = 577 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 511 RIVYIFLSAVFRRRGVLLFAPIFYFSGMLMYMDSLS 618 + VY+F+SA+FRRRG+LLFAP+ Y +GML+YM SLS Sbjct: 37 KFVYLFMSAIFRRRGLLLFAPLLYIAGMLLYMGSLS 72