BLASTX nr result
ID: Papaver23_contig00019434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00019434 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623422.1| Anthocyanin 3'-O-beta-glucosyltransferase [M... 76 2e-12 ref|XP_003623444.1| Anthocyanidin 3-O-glucosyltransferase [Medic... 71 8e-11 ref|XP_003623449.1| UDP-glucuronosyltransferase 1-1 [Medicago tr... 71 8e-11 ref|XP_002510179.1| UDP-glucosyltransferase, putative [Ricinus c... 71 1e-10 ref|XP_002518735.1| UDP-glucosyltransferase, putative [Ricinus c... 70 2e-10 >ref|XP_003623422.1| Anthocyanin 3'-O-beta-glucosyltransferase [Medicago truncatula] gi|355498437|gb|AES79640.1| Anthocyanin 3'-O-beta-glucosyltransferase [Medicago truncatula] Length = 500 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/67 (55%), Positives = 49/67 (73%) Frame = -2 Query: 431 DAEDVQVKKEKIANVVSRLTGDGEEGKNMRMRAKEIGEKAKVAVEEGGSSYENLTALIQE 252 +++DV VK+E+IA V L G G+E K MRMRAK++GE AK +EEGG SY NL LI E Sbjct: 426 ESKDVVVKREEIAKAVEILMGSGQESKEMRMRAKKLGEAAKRTIEEGGDSYNNLIQLIDE 485 Query: 251 LQMVKKA 231 L+ +KK+ Sbjct: 486 LKSLKKS 492 >ref|XP_003623444.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula] gi|355498459|gb|AES79662.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula] Length = 478 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/70 (51%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = -2 Query: 437 WID-AEDVQVKKEKIANVVSRLTGDGEEGKNMRMRAKEIGEKAKVAVEEGGSSYENLTAL 261 W+ E+V V++E+I V L G G+EGK MRMRAK++G+ AK +EEGG SY NL L Sbjct: 399 WLSIGEEVVVRREEIVKAVEILMGSGQEGKVMRMRAKKLGDAAKKTIEEGGDSYNNLIQL 458 Query: 260 IQELQMVKKA 231 I EL+ +K A Sbjct: 459 IDELKSLKIA 468 >ref|XP_003623449.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula] gi|355498464|gb|AES79667.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula] Length = 498 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = -2 Query: 422 DVQVKKEKIANVVSRLTGDGEEGKNMRMRAKEIGEKAKVAVEEGGSSYENLTALIQELQM 243 D V++E+I V L G G+E K MRMRAK++G+ AK +EEGG SY NL LI EL+ Sbjct: 427 DEMVRREEITKAVEILMGSGQESKEMRMRAKKLGDAAKRTIEEGGDSYNNLIQLIDELKS 486 Query: 242 VKKAST 225 +KK+ T Sbjct: 487 LKKSKT 492 >ref|XP_002510179.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223550880|gb|EEF52366.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 498 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/76 (44%), Positives = 47/76 (61%) Frame = -2 Query: 446 WNDWIDAEDVQVKKEKIANVVSRLTGDGEEGKNMRMRAKEIGEKAKVAVEEGGSSYENLT 267 W W E + ++ I N V R+ GDG E MR RA+ + E AK AVEEGGSSY +L Sbjct: 421 WKIWATQESPLMSRKNIENAVRRVVGDGGEAMEMRKRARRLAECAKKAVEEGGSSYNDLK 480 Query: 266 ALIQELQMVKKASTTR 219 +LI +++M K A+T + Sbjct: 481 SLIDDIRMYKHATTEK 496 >ref|XP_002518735.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542116|gb|EEF43660.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 473 Score = 70.1 bits (170), Expect = 2e-10 Identities = 37/73 (50%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -2 Query: 449 KWNDWIDAE-DVQVKKEKIANVVSRLTGDGEEGKNMRMRAKEIGEKAKVAVEEGGSSYEN 273 +W+ + D V ++K+ V RL +GEE R RAKE+GEKAK AVEEGGSSY+N Sbjct: 400 EWSSFKDPPLGATVGRDKVETAVKRLMAEGEEAAEFRRRAKELGEKAKRAVEEGGSSYKN 459 Query: 272 LTALIQELQMVKK 234 ALIQEL +K+ Sbjct: 460 ADALIQELISLKR 472