BLASTX nr result
ID: Papaver23_contig00016980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00016980 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633295.1| PREDICTED: uncharacterized protein LOC100853... 59 4e-07 >ref|XP_003633295.1| PREDICTED: uncharacterized protein LOC100853570 [Vitis vinifera] Length = 421 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/73 (32%), Positives = 36/73 (49%) Frame = -2 Query: 386 SWWISCMFSWWRFDRWCH*RSYSWHGGVHSWWFSRNYVRWRSNRCWSEWYFGRYPALWWY 207 +WW + ++WW RW R++ W WW R RWR R W W++ + WW+ Sbjct: 127 TWWRTWWWTWWWPRRWRWWRTWWWWRRKGRWWRRRPAWRWRRWRTW--WWWWSWRRAWWW 184 Query: 206 SMRRNTWWHGWYN 168 S RR W W++ Sbjct: 185 SWRRAWRWRWWWS 197