BLASTX nr result
ID: Papaver23_contig00016588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00016588 (658 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_636078.1| hypothetical protein DDB_G0289719 [Dictyosteliu... 55 9e-06 >ref|XP_636078.1| hypothetical protein DDB_G0289719 [Dictyostelium discoideum AX4] gi|60464424|gb|EAL62571.1| hypothetical protein DDB_G0289719 [Dictyostelium discoideum AX4] Length = 1419 Score = 55.5 bits (132), Expect = 9e-06 Identities = 41/153 (26%), Positives = 67/153 (43%), Gaps = 4/153 (2%) Frame = +2 Query: 209 EEIKAKASDENEKIRSTGEPVSTPAEKDQLSRKDNENFD--AKSYLVEKLDKEFSDSTKE 382 E+ K + E +KIR E EKD+ RK+ E D K EK KE ++ ++ Sbjct: 692 EKEKKRIEKEKKKIRENEEKERKQKEKDEKKRKEKEEKDRKEKEEKEEKERKENEENERK 751 Query: 383 EKSEIGSRFRSRNEEVRAQLENETDKDTKSRVEGDKKEKH--SHXXXXXXXXXXXXXXXX 556 EK E + + R E+ + + + +K+ K + E +KEK Sbjct: 752 EKEEKKRKEKERKEKEEKERKEKEEKEIKEKEEKKRKEKEEKDRKEKERKENEEKKRKEK 811 Query: 557 PDKVTKSKGKRDKPEKSRHYRIRNEEISRDDME 655 +K K K +R+K EK R + + E+ R+ E Sbjct: 812 EEKERKEKEEREKQEKEREEKEKQEKEERERKE 844