BLASTX nr result
ID: Papaver23_contig00016283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00016283 (767 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318513.1| predicted protein [Populus trichocarpa] gi|2... 94 3e-17 ref|NP_175250.1| signal recognition particle subunit SRP19 [Arab... 90 5e-16 ref|XP_002894097.1| predicted protein [Arabidopsis lyrata subsp.... 90 6e-16 ref|XP_002321521.1| predicted protein [Populus trichocarpa] gi|2... 89 8e-16 ref|XP_002866154.1| hypothetical protein ARALYDRAFT_357880 [Arab... 89 1e-15 >ref|XP_002318513.1| predicted protein [Populus trichocarpa] gi|222859186|gb|EEE96733.1| predicted protein [Populus trichocarpa] Length = 136 Score = 94.0 bits (232), Expect = 3e-17 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = -3 Query: 765 EINKAYPRDFMQVGRVRVQLKREDGTLCNPDIKSRKDMMHQVASMVPRHPGRNKKQ 598 EI+KAYPRDFMQVGRVRV LKREDG+LCNP I SRK +M VA +VPRHPGR KKQ Sbjct: 60 EIDKAYPRDFMQVGRVRVLLKREDGSLCNPAIPSRKQLMFHVAELVPRHPGRTKKQ 115 >ref|NP_175250.1| signal recognition particle subunit SRP19 [Arabidopsis thaliana] gi|21542239|sp|Q943Z6.1|SRP19_ARATH RecName: Full=Signal recognition particle 19 kDa protein; Short=SRP19 gi|16612311|gb|AAL27515.1|AF439847_1 At1g48160/F21D18_11 [Arabidopsis thaliana] gi|21593920|gb|AAM65885.1| signal recognition particle 19 kDa protein subunit, putative [Arabidopsis thaliana] gi|21928099|gb|AAM78078.1| At1g48160/F21D18_11 [Arabidopsis thaliana] gi|332194136|gb|AEE32257.1| signal recognition particle subunit SRP19 [Arabidopsis thaliana] Length = 145 Score = 90.1 bits (222), Expect = 5e-16 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -3 Query: 765 EINKAYPRDFMQVGRVRVQLKREDGTLCNPDIKSRKDMMHQVASMVPRHPGRNKKQ 598 EI+KAYPRDFMQVGRVRVQLKREDGTL NP I SRK +M ++A +VPRHP R KKQ Sbjct: 59 EIDKAYPRDFMQVGRVRVQLKREDGTLLNPAITSRKHLMQKIAELVPRHPERVKKQ 114 >ref|XP_002894097.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297339939|gb|EFH70356.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 145 Score = 89.7 bits (221), Expect = 6e-16 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -3 Query: 765 EINKAYPRDFMQVGRVRVQLKREDGTLCNPDIKSRKDMMHQVASMVPRHPGRNKKQ 598 EI+KAYPRDFMQVGRVRVQLKREDGTL NP I SRK ++ ++A +VPRHP R KKQ Sbjct: 59 EIDKAYPRDFMQVGRVRVQLKREDGTLLNPSITSRKHLLQKIAELVPRHPERVKKQ 114 >ref|XP_002321521.1| predicted protein [Populus trichocarpa] gi|222868517|gb|EEF05648.1| predicted protein [Populus trichocarpa] Length = 136 Score = 89.4 bits (220), Expect = 8e-16 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -3 Query: 765 EINKAYPRDFMQVGRVRVQLKREDGTLCNPDIKSRKDMMHQVASMVPRHPGRNKKQ 598 EI+KAYPRDFMQVGRVRV LKREDG+L NP I SRK +M VA +VPRHPGR KKQ Sbjct: 60 EIDKAYPRDFMQVGRVRVLLKREDGSLSNPAIPSRKQLMLHVAELVPRHPGRTKKQ 115 >ref|XP_002866154.1| hypothetical protein ARALYDRAFT_357880 [Arabidopsis lyrata subsp. lyrata] gi|297311989|gb|EFH42413.1| hypothetical protein ARALYDRAFT_357880 [Arabidopsis lyrata subsp. lyrata] Length = 145 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -3 Query: 765 EINKAYPRDFMQVGRVRVQLKREDGTLCNPDIKSRKDMMHQVASMVPRHPGRNKKQ 598 EI+KAYPRDFMQVGRVRVQLKREDGTL NP I SRK ++ ++A +VPRHP R KKQ Sbjct: 59 EIDKAYPRDFMQVGRVRVQLKREDGTLLNPAITSRKHLLQKIAELVPRHPERVKKQ 114