BLASTX nr result
ID: Papaver23_contig00015552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00015552 (955 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525353.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 ref|XP_002315807.1| predicted protein [Populus trichocarpa] gi|2... 58 4e-06 >ref|XP_002525353.1| conserved hypothetical protein [Ricinus communis] gi|223535316|gb|EEF36991.1| conserved hypothetical protein [Ricinus communis] Length = 948 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/53 (45%), Positives = 41/53 (77%) Frame = +2 Query: 398 AVIDQHEMYEKMRPWIGEEIRELLKKEKTSVVDQVINGIRKQNRPSQILELLE 556 AV D+HE++E+MRPWI ++I E L +E+T++VD +++ R + SQ+LE+L+ Sbjct: 861 AVYDRHELHERMRPWISKKITEFLGEEETTLVDYIVSSTRDHVKASQMLEMLQ 913 >ref|XP_002315807.1| predicted protein [Populus trichocarpa] gi|222864847|gb|EEF01978.1| predicted protein [Populus trichocarpa] Length = 894 Score = 57.8 bits (138), Expect = 4e-06 Identities = 23/53 (43%), Positives = 42/53 (79%) Frame = +2 Query: 398 AVIDQHEMYEKMRPWIGEEIRELLKKEKTSVVDQVINGIRKQNRPSQILELLE 556 AV D+HE++E+MRPWI ++I E L +E+T++VD +++ ++ + SQ+LE+L+ Sbjct: 807 AVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQEHVKASQMLEMLQ 859