BLASTX nr result
ID: Papaver23_contig00014688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014688 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617804.1| Outward rectifying potassium channel [Medica... 74 2e-11 gb|AFK36087.1| unknown [Lotus japonicus] 72 6e-11 ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectify... 72 6e-11 ref|XP_003519630.1| PREDICTED: calcium-activated outward-rectify... 72 6e-11 dbj|BAF74750.1| potassium channel [Nicotiana tabacum] 71 8e-11 >ref|XP_003617804.1| Outward rectifying potassium channel [Medicago truncatula] gi|355519139|gb|AET00763.1| Outward rectifying potassium channel [Medicago truncatula] Length = 349 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 468 FILYKLKEMGKVQQEDIVLLMKEFENLDVDQSGTISTSDITLA 340 F++YKLKEMGK+ QEDI L+MKEFE LD+DQSGT+S SDITLA Sbjct: 304 FVIYKLKEMGKISQEDITLVMKEFEELDIDQSGTLSVSDITLA 346 >gb|AFK36087.1| unknown [Lotus japonicus] Length = 349 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 468 FILYKLKEMGKVQQEDIVLLMKEFENLDVDQSGTISTSDITLA 340 F++YKLKEMGK+ QEDI L +KEFE LDVDQSGT+S SDITLA Sbjct: 304 FVIYKLKEMGKISQEDISLFLKEFEELDVDQSGTLSVSDITLA 346 >ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 1 [Glycine max] gi|356552609|ref|XP_003544657.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 2 [Glycine max] Length = 348 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 468 FILYKLKEMGKVQQEDIVLLMKEFENLDVDQSGTISTSDITLA 340 F++YKLKEMGK+ QEDI L+M+EFE LDVD SGT+STSDITLA Sbjct: 303 FVIYKLKEMGKISQEDISLVMQEFEQLDVDDSGTLSTSDITLA 345 >ref|XP_003519630.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like [Glycine max] Length = 349 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 468 FILYKLKEMGKVQQEDIVLLMKEFENLDVDQSGTISTSDITLA 340 F++YKLKEMGK+ QEDI L+M+EFE LDVD SGT+STSDITLA Sbjct: 304 FVIYKLKEMGKISQEDISLVMQEFEQLDVDDSGTLSTSDITLA 346 >dbj|BAF74750.1| potassium channel [Nicotiana tabacum] Length = 349 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -3 Query: 468 FILYKLKEMGKVQQEDIVLLMKEFENLDVDQSGTISTSDITLA 340 F++YKLKEMGK+ Q+D+ LL+ EFENLDVDQSGT+ST+D+TLA Sbjct: 304 FVVYKLKEMGKINQDDVSLLLDEFENLDVDQSGTLSTTDLTLA 346