BLASTX nr result
ID: Papaver23_contig00014642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014642 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299663.1| predicted protein [Populus trichocarpa] gi|2... 44 2e-06 ref|XP_002313553.1| predicted protein [Populus trichocarpa] gi|2... 42 1e-05 >ref|XP_002299663.1| predicted protein [Populus trichocarpa] gi|222846921|gb|EEE84468.1| predicted protein [Populus trichocarpa] Length = 951 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = +3 Query: 228 TVSPRLSGLQRP*VRTATSTNDELATDAL--NSWF*ALVEDYALGCYFFSGNSY 383 T+S RL QRP VR T NDELATDAL + + +DY+L FSG+SY Sbjct: 318 TISSRLGNAQRPEVRVVTWNNDELATDALPVHGFEHYKAKDYSLAHAPFSGSSY 371 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 386 GGRWGAWDALMYRILSPKDVVFCLQR 463 GG+W A D +Y I+SPKDVV R Sbjct: 373 GGQWAAGDEPLYYIVSPKDVVIAKPR 398 >ref|XP_002313553.1| predicted protein [Populus trichocarpa] gi|222849961|gb|EEE87508.1| predicted protein [Populus trichocarpa] Length = 952 Score = 41.6 bits (96), Expect(2) = 1e-05 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +3 Query: 228 TVSPRLSGLQRP*VRTATSTNDELATDAL--NSWF*ALVEDYALGCYFFSGNSY 383 T+S R QRP VR T NDELATDAL + + +DY+L FSG+SY Sbjct: 319 TISSRQGNAQRPEVRVVTWNNDELATDALPVHRFEHYKAKDYSLAHAPFSGSSY 372 Score = 32.3 bits (72), Expect(2) = 1e-05 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 386 GGRWGAWDALMYRILSPKDVVFCLQR 463 GG+W A D +Y I+SPKDVV R Sbjct: 374 GGQWAAGDEPLYYIVSPKDVVIAKPR 399