BLASTX nr result
ID: Papaver23_contig00014496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014496 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275849.2| PREDICTED: putative Holliday junction resolv... 62 8e-08 emb|CBI16584.3| unnamed protein product [Vitis vinifera] 62 8e-08 emb|CAN65349.1| hypothetical protein VITISV_000639 [Vitis vinifera] 62 8e-08 ref|XP_002527775.1| hydrolase, acting on ester bonds, putative [... 56 4e-06 >ref|XP_002275849.2| PREDICTED: putative Holliday junction resolvase [Vitis vinifera] Length = 229 Score = 61.6 bits (148), Expect = 8e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SSSGERTKLVLPKQLELQEKLRQGPPRDLDFFPEELD 112 S +G+ T+LVLPKQLELQEKLR+GPP+D DFFPE+ D Sbjct: 192 SMAGQGTELVLPKQLELQEKLRRGPPKDADFFPEDFD 228 >emb|CBI16584.3| unnamed protein product [Vitis vinifera] Length = 679 Score = 61.6 bits (148), Expect = 8e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SSSGERTKLVLPKQLELQEKLRQGPPRDLDFFPEELD 112 S +G+ T+LVLPKQLELQEKLR+GPP+D DFFPE+ D Sbjct: 642 SMAGQGTELVLPKQLELQEKLRRGPPKDADFFPEDFD 678 >emb|CAN65349.1| hypothetical protein VITISV_000639 [Vitis vinifera] Length = 213 Score = 61.6 bits (148), Expect = 8e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SSSGERTKLVLPKQLELQEKLRQGPPRDLDFFPEELD 112 S +G+ T+LVLPKQLELQEKLR+GPP+D DFFPE+ D Sbjct: 176 SMAGQGTELVLPKQLELQEKLRRGPPKDADFFPEDFD 212 >ref|XP_002527775.1| hydrolase, acting on ester bonds, putative [Ricinus communis] gi|223532810|gb|EEF34585.1| hydrolase, acting on ester bonds, putative [Ricinus communis] Length = 239 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/34 (64%), Positives = 33/34 (97%) Frame = +2 Query: 2 SSSGERTKLVLPKQLELQEKLRQGPPRDLDFFPE 103 ++SGE T+LV+PK+L+LQ+KLR+GPP+D+DF+PE Sbjct: 206 AASGEGTELVIPKRLDLQDKLRKGPPKDIDFYPE 239