BLASTX nr result
ID: Papaver23_contig00014337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014337 (590 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617804.1| Outward rectifying potassium channel [Medica... 68 1e-09 ref|XP_002310924.1| outward rectifying potassium channel [Populu... 66 4e-09 gb|AFK36087.1| unknown [Lotus japonicus] 66 5e-09 gb|AAD16279.1| pulvinus outward-rectifying channel for potassium... 65 9e-09 ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectify... 65 1e-08 >ref|XP_003617804.1| Outward rectifying potassium channel [Medicago truncatula] gi|355519139|gb|AET00763.1| Outward rectifying potassium channel [Medicago truncatula] Length = 349 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 588 FILYKLKEMGKIQQEDIVPLMKEFEELDVDQSGMISTSDIT 466 F++YKLKEMGKI QEDI +MKEFEELD+DQSG +S SDIT Sbjct: 304 FVIYKLKEMGKISQEDITLVMKEFEELDIDQSGTLSVSDIT 344 >ref|XP_002310924.1| outward rectifying potassium channel [Populus trichocarpa] gi|222850744|gb|EEE88291.1| outward rectifying potassium channel [Populus trichocarpa] Length = 354 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 588 FILYKLKEMGKIQQEDIVPLMKEFEELDVDQSGMISTSDIT 466 FILYKLKEMGKI QEDI +M+EFE+LDVDQSG +S SDIT Sbjct: 305 FILYKLKEMGKISQEDIALVMEEFEDLDVDQSGTLSDSDIT 345 >gb|AFK36087.1| unknown [Lotus japonicus] Length = 349 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 588 FILYKLKEMGKIQQEDIVPLMKEFEELDVDQSGMISTSDIT 466 F++YKLKEMGKI QEDI +KEFEELDVDQSG +S SDIT Sbjct: 304 FVIYKLKEMGKISQEDISLFLKEFEELDVDQSGTLSVSDIT 344 >gb|AAD16279.1| pulvinus outward-rectifying channel for potassium SPOCK1 [Samanea saman] Length = 352 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 588 FILYKLKEMGKIQQEDIVPLMKEFEELDVDQSGMISTSDIT 466 FI+YKLKEMGKI QEDI +M++FEELDVDQSG +S SD+T Sbjct: 304 FIIYKLKEMGKISQEDIALIMQQFEELDVDQSGTLSPSDLT 344 >ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 1 [Glycine max] gi|356552609|ref|XP_003544657.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 2 [Glycine max] Length = 348 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 588 FILYKLKEMGKIQQEDIVPLMKEFEELDVDQSGMISTSDIT 466 F++YKLKEMGKI QEDI +M+EFE+LDVD SG +STSDIT Sbjct: 303 FVIYKLKEMGKISQEDISLVMQEFEQLDVDDSGTLSTSDIT 343