BLASTX nr result
ID: Papaver23_contig00014069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014069 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266427.1| PREDICTED: transcription factor AS1 [Vitis v... 71 1e-10 ref|XP_002533297.1| asymmetric leaves1 and rough sheath, putativ... 68 9e-10 ref|XP_002530981.1| asymmetric leaves1 and rough sheath, putativ... 66 3e-09 dbj|BAL41338.1| putative ASYMMETRIC LEAVES1, partial [Cayratia t... 65 4e-09 dbj|BAM11089.1| putative ASYMMETRIC LEAVES1, partial [Cayratia t... 65 7e-09 >ref|XP_002266427.1| PREDICTED: transcription factor AS1 [Vitis vinifera] Length = 358 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 116 PHGSVSTNGERLIVTELSDCCRELEEGHRAWAAHKKEA 3 PHG+V T+GE L+++EL +CCRELEEGHRAWAAHKKEA Sbjct: 225 PHGAVPTSGENLLISELVECCRELEEGHRAWAAHKKEA 262 >ref|XP_002533297.1| asymmetric leaves1 and rough sheath, putative [Ricinus communis] gi|223526881|gb|EEF29091.1| asymmetric leaves1 and rough sheath, putative [Ricinus communis] Length = 349 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 116 PHGSVSTNGERLIVTELSDCCRELEEGHRAWAAHKKEA 3 PHGSV + GE L+V+EL DCCR+LEEG+RAWAAHKKEA Sbjct: 224 PHGSVPSCGENLVVSELVDCCRQLEEGYRAWAAHKKEA 261 >ref|XP_002530981.1| asymmetric leaves1 and rough sheath, putative [Ricinus communis] gi|223529433|gb|EEF31393.1| asymmetric leaves1 and rough sheath, putative [Ricinus communis] Length = 359 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 116 PHGSVSTNGERLIVTELSDCCRELEEGHRAWAAHKKEA 3 PHGS+ GE L+V+EL DCCRELEEG+RAW+AHKKEA Sbjct: 226 PHGSLPACGENLVVSELVDCCRELEEGYRAWSAHKKEA 263 >dbj|BAL41338.1| putative ASYMMETRIC LEAVES1, partial [Cayratia trifolia] gi|363809066|dbj|BAL41664.1| putative ASYMMETRIC LEAVES1, partial [Cayratia trifolia] Length = 240 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -1 Query: 116 PHGSVSTNGERLIVTELSDCCRELEEGHRAWAAHKKEA 3 PHG+V +GE +++E+ +CCRELEEGHRAWAAHKKEA Sbjct: 180 PHGTVPASGENSLISEVLECCRELEEGHRAWAAHKKEA 217 >dbj|BAM11089.1| putative ASYMMETRIC LEAVES1, partial [Cayratia tenuifolia] gi|384080855|dbj|BAM11090.1| putative ASYMMETRIC LEAVES1, partial [Cayratia tenuifolia] Length = 240 Score = 64.7 bits (156), Expect = 7e-09 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -1 Query: 116 PHGSVSTNGERLIVTELSDCCRELEEGHRAWAAHKKEA 3 PHG+V +GE +++E+ +CCRELEEGHRAWAAHKKEA Sbjct: 180 PHGTVPGSGENSLISEVLECCRELEEGHRAWAAHKKEA 217