BLASTX nr result
ID: Papaver23_contig00014055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014055 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633847.1| PREDICTED: probable ubiquitin conjugation fa... 81 1e-13 ref|XP_004136686.1| PREDICTED: probable ubiquitin conjugation fa... 78 6e-13 ref|XP_002964116.1| ubiquitin-protein ligase, UFD2 [Selaginella ... 78 6e-13 ref|XP_002992051.1| ubiquitin-protein ligase, UFD2 [Selaginella ... 78 6e-13 ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus ... 78 6e-13 >ref|XP_003633847.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Vitis vinifera] gi|296082973|emb|CBI22274.3| unnamed protein product [Vitis vinifera] Length = 1037 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/64 (60%), Positives = 53/64 (82%), Gaps = 1/64 (1%) Frame = +1 Query: 1 PIEFKLMEDPVVLPSTK-TVDRSVIQRHLLNYDTDPFNGLPLTQEMIIPNVELKAKIVKF 177 PI++ LM+DPV+LPS++ TVDR VIQRHLL+ +TDPFN LT +M+IPN+ELKA+I +F Sbjct: 945 PIQYTLMKDPVILPSSRITVDRPVIQRHLLSDNTDPFNRSHLTSDMLIPNIELKARIEEF 1004 Query: 178 TNSK 189 S+ Sbjct: 1005 IRSQ 1008 >ref|XP_004136686.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Cucumis sativus] gi|449494681|ref|XP_004159617.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Cucumis sativus] Length = 1043 Score = 78.2 bits (191), Expect = 6e-13 Identities = 39/64 (60%), Positives = 51/64 (79%), Gaps = 1/64 (1%) Frame = +1 Query: 1 PIEFKLMEDPVVLPSTK-TVDRSVIQRHLLNYDTDPFNGLPLTQEMIIPNVELKAKIVKF 177 PI++ LM+DPV+LPS++ TVDR VIQRHLL+ TDPFN LT +M+IPN ELKA+I +F Sbjct: 951 PIQYTLMKDPVILPSSRITVDRPVIQRHLLSDSTDPFNRSHLTADMLIPNEELKARIKEF 1010 Query: 178 TNSK 189 S+ Sbjct: 1011 IRSQ 1014 >ref|XP_002964116.1| ubiquitin-protein ligase, UFD2 [Selaginella moellendorffii] gi|300167845|gb|EFJ34449.1| ubiquitin-protein ligase, UFD2 [Selaginella moellendorffii] Length = 1015 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/60 (61%), Positives = 50/60 (83%), Gaps = 1/60 (1%) Frame = +1 Query: 1 PIEFKLMEDPVVLPSTKT-VDRSVIQRHLLNYDTDPFNGLPLTQEMIIPNVELKAKIVKF 177 PI++ LM+DPV+LPS+KT +DR+ IQRHLL+ TDPFN LT +M++PNVELKA+I +F Sbjct: 949 PIQYTLMKDPVILPSSKTTIDRATIQRHLLSDQTDPFNRSLLTADMLVPNVELKARIEEF 1008 >ref|XP_002992051.1| ubiquitin-protein ligase, UFD2 [Selaginella moellendorffii] gi|300140173|gb|EFJ06900.1| ubiquitin-protein ligase, UFD2 [Selaginella moellendorffii] Length = 1015 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/60 (61%), Positives = 50/60 (83%), Gaps = 1/60 (1%) Frame = +1 Query: 1 PIEFKLMEDPVVLPSTKT-VDRSVIQRHLLNYDTDPFNGLPLTQEMIIPNVELKAKIVKF 177 PI++ LM+DPV+LPS+KT +DR+ IQRHLL+ TDPFN LT +M++PNVELKA+I +F Sbjct: 949 PIQYTLMKDPVILPSSKTTIDRATIQRHLLSDQTDPFNRSLLTADMLVPNVELKARIEEF 1008 >ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527331|gb|EEF29477.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1031 Score = 78.2 bits (191), Expect = 6e-13 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 1/64 (1%) Frame = +1 Query: 1 PIEFKLMEDPVVLPSTK-TVDRSVIQRHLLNYDTDPFNGLPLTQEMIIPNVELKAKIVKF 177 PI++ LM+DPV+LPS++ T+DR VIQRHLL+ TDPFN LT +M+IPNVELKA+I +F Sbjct: 940 PIQYTLMKDPVILPSSRITIDRPVIQRHLLSDATDPFNRSHLTADMLIPNVELKARIEEF 999 Query: 178 TNSK 189 ++ Sbjct: 1000 IRNQ 1003