BLASTX nr result
ID: Papaver23_contig00013232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00013232 (1193 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66750.1| hypothetical protein VITISV_034413 [Vitis vinifera] 42 7e-07 ref|XP_003634352.1| PREDICTED: RNA pseudourine synthase 2, chlor... 42 7e-07 ref|XP_003563280.1| PREDICTED: RNA pseudourine synthase 2, chlor... 42 1e-06 ref|XP_003523282.1| PREDICTED: RNA pseudourine synthase 2, chlor... 41 3e-06 ref|XP_002519370.1| ribosomal pseudouridine synthase, putative [... 40 3e-06 >emb|CAN66750.1| hypothetical protein VITISV_034413 [Vitis vinifera] Length = 611 Score = 42.0 bits (97), Expect(2) = 7e-07 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 631 IRAHAKHLGYPLLGDEVYVGTK 566 IRAHAK+LG PLLGDEVY GTK Sbjct: 481 IRAHAKYLGIPLLGDEVYGGTK 502 Score = 38.5 bits (88), Expect(2) = 7e-07 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 560 ALSRLRHKTPSNMHNYLPEMVDKFQRPCQHVYALG 456 ALS LR + PS+ H L ++V + RPC H ALG Sbjct: 505 ALSLLRPRIPSSHHGQLAQLVSRLDRPCLHAVALG 539 >ref|XP_003634352.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Vitis vinifera] gi|302141717|emb|CBI18920.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 42.0 bits (97), Expect(2) = 7e-07 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 631 IRAHAKHLGYPLLGDEVYVGTK 566 IRAHAK+LG PLLGDEVY GTK Sbjct: 335 IRAHAKYLGIPLLGDEVYGGTK 356 Score = 38.5 bits (88), Expect(2) = 7e-07 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 560 ALSRLRHKTPSNMHNYLPEMVDKFQRPCQHVYALG 456 ALS LR + PS+ H L ++V + RPC H ALG Sbjct: 359 ALSLLRPRIPSSHHGQLAQLVSRLDRPCLHAVALG 393 >ref|XP_003563280.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Brachypodium distachyon] Length = 439 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 631 IRAHAKHLGYPLLGDEVYVGTK 566 IRAHAK+LGYPLLGDE Y G+K Sbjct: 335 IRAHAKYLGYPLLGDETYGGSK 356 Score = 37.7 bits (86), Expect(2) = 1e-06 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -1 Query: 560 ALSRLRHKTPSNMHNYLPEMVDKFQRPCQHVYALG 456 ALS LR +TPS H L ++ K RPC H LG Sbjct: 359 ALSLLRPRTPSRYHGDLSNLISKIDRPCLHAALLG 393 >ref|XP_003523282.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Glycine max] Length = 450 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 631 IRAHAKHLGYPLLGDEVYVGTK 566 IRAHAK+LG PLLGDE+Y GTK Sbjct: 349 IRAHAKYLGVPLLGDELYGGTK 370 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -1 Query: 557 LSRLRHKTPSNMHNYLPEMVDKFQRPCQHVYALG 456 LS LR +TP ++H+ + +MV + RPC H + LG Sbjct: 374 LSLLRPRTPISLHSKIVKMVSRLDRPCLHAWTLG 407 >ref|XP_002519370.1| ribosomal pseudouridine synthase, putative [Ricinus communis] gi|223541437|gb|EEF42987.1| ribosomal pseudouridine synthase, putative [Ricinus communis] Length = 399 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 631 IRAHAKHLGYPLLGDEVYVGTK 566 IRAHAK++G PLLGDEVY GT+ Sbjct: 327 IRAHAKYIGIPLLGDEVYGGTR 348 Score = 38.5 bits (88), Expect(2) = 3e-06 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 560 ALSRLRHKTPSNMHNYLPEMVDKFQRPCQHVYALG*VYHVVAC 432 ALS LR + PS H+ L ++ K +RPC H ALG +AC Sbjct: 351 ALSLLRPRIPSTCHSELSLLLSKLERPCLHALALGSNQLKIAC 393