BLASTX nr result
ID: Papaver23_contig00012506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00012506 (713 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO35315.1| hypothetical protein [Amblyomma maculatum] 93 6e-17 gb|AAO12871.1| submergence induced protein 2-like, partial [Viti... 92 1e-16 sp|F6HDT7.1|MTND2_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-met... 90 4e-16 emb|CBI26309.3| unnamed protein product [Vitis vinifera] 90 4e-16 ref|XP_003631995.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 90 4e-16 >gb|AEO35315.1| hypothetical protein [Amblyomma maculatum] Length = 199 Score = 92.8 bits (229), Expect = 6e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +1 Query: 1 TLDSDNYIKAMRLFVGEPVWTPYNRPHDELPARKEYLDTFIKKEASNHAV 150 TLDS NYIKA+RLFVGEPVWTPYNRPHD+LPARKEYL+ F+K E N+AV Sbjct: 147 TLDSSNYIKALRLFVGEPVWTPYNRPHDDLPARKEYLEAFVKNEVGNNAV 196 >gb|AAO12871.1| submergence induced protein 2-like, partial [Vitis vinifera] Length = 91 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +1 Query: 1 TLDSDNYIKAMRLFVGEPVWTPYNRPHDELPARKEYLDTFIKKEASNHAV 150 TLDS+NYIKAMRLFVG+PVWTP+NRPHD LPAR+EYL+ F +KEA+NHAV Sbjct: 38 TLDSNNYIKAMRLFVGDPVWTPFNRPHDNLPARQEYLEAFGQKEAANHAV 87 >sp|F6HDT7.1|MTND2_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 2; Short=ARD 2; Short=Fe-ARD 2 Length = 199 Score = 90.1 bits (222), Expect = 4e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +1 Query: 1 TLDSDNYIKAMRLFVGEPVWTPYNRPHDELPARKEYLDTFIKKEASNHAV 150 TLDS+NYIKAMRLFVG+PVWTP+NRPHD LPAR+EYL+ F +KEA+NH V Sbjct: 146 TLDSNNYIKAMRLFVGDPVWTPFNRPHDNLPARQEYLEAFGQKEAANHVV 195 >emb|CBI26309.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 90.1 bits (222), Expect = 4e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +1 Query: 1 TLDSDNYIKAMRLFVGEPVWTPYNRPHDELPARKEYLDTFIKKEASNHAV 150 TLDS+NYIKAMRLFVG+PVWTP+NRPHD LPAR+EYL+ F +KEA+NH V Sbjct: 159 TLDSNNYIKAMRLFVGDPVWTPFNRPHDNLPARQEYLEAFGQKEAANHVV 208 >ref|XP_003631995.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Vitis vinifera] Length = 373 Score = 90.1 bits (222), Expect = 4e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +1 Query: 1 TLDSDNYIKAMRLFVGEPVWTPYNRPHDELPARKEYLDTFIKKEASNHAV 150 TLDS+NYIKAMRLFVG+PVWTP+NRPHD LPAR+EYL+ F +KEA+NH V Sbjct: 320 TLDSNNYIKAMRLFVGDPVWTPFNRPHDNLPARQEYLEAFGQKEAANHVV 369 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +1 Query: 1 TLDSDNYIKAMRLFVGEPVWTPYNRPHDELPARKEYLDTFIKKE 132 TLD+ NY+K MRLFVGEPVWT YNRP + PARK Y++ K+ Sbjct: 137 TLDTGNYVKLMRLFVGEPVWTAYNRPQEHHPARKNYINNVTHKD 180