BLASTX nr result
ID: Papaver23_contig00011779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00011779 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 90 2e-16 gb|AFI47457.1| low temperature and salt responsive protein [Medi... 90 2e-16 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 90 2e-16 ref|XP_002884539.1| low temperature and salt responsive protein ... 90 2e-16 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 90 2e-16 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 501 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAIFVITK 367 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+++ITK Sbjct: 10 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 89.7 bits (221), Expect = 2e-16 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 501 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAIFVITK 367 ILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGI+YAI+VITK Sbjct: 10 ILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAIYVITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 501 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAIFVITK 367 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+++ITK Sbjct: 682 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 501 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAIFVITK 367 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+++ITK Sbjct: 10 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 501 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAIFVITK 367 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+++ITK Sbjct: 10 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54