BLASTX nr result
ID: Papaver23_contig00010986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00010986 (511 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN39418.1| obtusifoliol-14-demethylase [Withania somnifera] 75 7e-12 gb|AAL54888.1|AF116915_1 obtusifoliol-14-demethylase [Nicotiana ... 75 7e-12 gb|AAL40888.1| obtusifoliol-14-demethylase [Nicotiana tabacum] 75 7e-12 ref|NP_172633.1| cytochrome P450, family 51 (sterol 14-demethyla... 75 7e-12 ref|NP_001234537.1| obtusifoliol 14alpha-demethylase [Solanum ly... 75 7e-12 >gb|ADN39418.1| obtusifoliol-14-demethylase [Withania somnifera] Length = 487 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 LRNFEFEMVSPFPEIDWNAMVVGVKGNVMVRYKRRKL 112 LRNFEFE++SPFPEIDWNAMVVGVKG VMV+YKRRKL Sbjct: 448 LRNFEFELISPFPEIDWNAMVVGVKGEVMVKYKRRKL 484 >gb|AAL54888.1|AF116915_1 obtusifoliol-14-demethylase [Nicotiana tabacum] Length = 487 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 LRNFEFEMVSPFPEIDWNAMVVGVKGNVMVRYKRRKL 112 LRNFEFE++SPFPEIDWNAMVVGVKG VMV+YKRRKL Sbjct: 448 LRNFEFELISPFPEIDWNAMVVGVKGKVMVKYKRRKL 484 >gb|AAL40888.1| obtusifoliol-14-demethylase [Nicotiana tabacum] Length = 487 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 LRNFEFEMVSPFPEIDWNAMVVGVKGNVMVRYKRRKL 112 LRNFEFE++SPFPEIDWNAMVVGVKG VMV+YKRRKL Sbjct: 448 LRNFEFELISPFPEIDWNAMVVGVKGKVMVKYKRRKL 484 >ref|NP_172633.1| cytochrome P450, family 51 (sterol 14-demethylase) [Arabidopsis thaliana] gi|75313134|sp|Q9SAA9.1|CP511_ARATH RecName: Full=Sterol 14-demethylase; AltName: Full=Cytochrome P450 51A2; AltName: Full=Cytochrome P450 51G1; Short=AtCYP51; AltName: Full=Obtusifoliol 14-demethylase; AltName: Full=Protein EMBRYO DEFECTIVE 1738 gi|4835788|gb|AAD30254.1|AC007296_15 Strong similarity to gb|U74319 obtusifoliol 14-alpha demethylase (CYP51) from Sorghum bicolor and is a member of the PF|00067 cytochrome P450 family. ESTs gb|AA72030, gb|N65031 and gb|AA651059 come from this gene [Arabidopsis thaliana] gi|15294294|gb|AAK95324.1|AF410338_1 At1g11680/F25C20_17 [Arabidopsis thaliana] gi|14624983|dbj|BAB61873.1| obtusifoliol 14-demethylase [Arabidopsis thaliana] gi|15292853|gb|AAK92797.1| putative obtusifoliol 14-alpha demethylase [Arabidopsis thaliana] gi|20258897|gb|AAM14142.1| putative obtusifoliol 14-alpha demethylase [Arabidopsis thaliana] gi|21536753|gb|AAM61085.1| putative obtusifoliol 14-alpha demethylase [Arabidopsis thaliana] gi|332190648|gb|AEE28769.1| cytochrome P450, family 51 (sterol 14-demethylase) [Arabidopsis thaliana] Length = 488 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 LRNFEFEMVSPFPEIDWNAMVVGVKGNVMVRYKRRKL 112 LRNFE E+VSPFPEIDWNAMVVGVKGNVMVRYKRR+L Sbjct: 451 LRNFELELVSPFPEIDWNAMVVGVKGNVMVRYKRRQL 487 >ref|NP_001234537.1| obtusifoliol 14alpha-demethylase [Solanum lycopersicum] gi|299735181|gb|ADJ37071.1| obtusifoliol 14alpha-demethylase [Solanum lycopersicum] Length = 487 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 LRNFEFEMVSPFPEIDWNAMVVGVKGNVMVRYKRRKL 112 LRNFEFE++SPFPEIDWNAMVVGVKG VMV+YKRRKL Sbjct: 448 LRNFEFELISPFPEIDWNAMVVGVKGEVMVKYKRRKL 484