BLASTX nr result
ID: Papaver23_contig00010959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00010959 (600 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316143.1| integral membrane single C2 domain protein [... 56 6e-06 >ref|XP_002316143.1| integral membrane single C2 domain protein [Populus trichocarpa] gi|222865183|gb|EEF02314.1| integral membrane single C2 domain protein [Populus trichocarpa] Length = 669 Score = 55.8 bits (133), Expect = 6e-06 Identities = 36/89 (40%), Positives = 54/89 (60%), Gaps = 3/89 (3%) Frame = -1 Query: 258 SSYQHHRKRRRRLECIGCMLPTNTGGGNPNFDSDRQS---VVKSLGFTDELDDEYKEIEA 88 +++ RRR L C++P +T N N + + + V+K + ++EL+ E E+ Sbjct: 48 TNFTQQNLRRRFLTFHACVIPNDTRNRNVNIELSKGTKGFVLKRI--SNELETE--ELSQ 103 Query: 87 ENSIQVPSNFTSFQQDPLVAKLRTQLGVI 1 E+SI SNFT FQ+DP+V KLRTQLGVI Sbjct: 104 EHSI---SNFTGFQEDPIVGKLRTQLGVI 129