BLASTX nr result
ID: Papaver23_contig00010573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00010573 (821 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521019.1| protein transporter, putative [Ricinus commu... 62 1e-10 ref|XP_002307637.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-10 gb|ACD62528.1| bet1-like snare 1-1 [Malus x domestica] 57 1e-09 ref|XP_002300787.1| predicted protein [Populus trichocarpa] gi|2... 54 2e-09 ref|XP_002878192.1| ATBS14A [Arabidopsis lyrata subsp. lyrata] g... 62 2e-09 >ref|XP_002521019.1| protein transporter, putative [Ricinus communis] gi|223539856|gb|EEF41436.1| protein transporter, putative [Ricinus communis] Length = 125 Score = 62.0 bits (149), Expect(2) = 1e-10 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 720 GGIRAAPSYSHEIDEQENDRAMDGLQDRVLLLKR 821 GGIRA+ SYSHEIDEQ+N+RAM+GLQDRV+LLKR Sbjct: 24 GGIRASSSYSHEIDEQDNERAMEGLQDRVILLKR 57 Score = 30.8 bits (68), Expect(2) = 1e-10 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +1 Query: 673 RDYRNNRSALFDGIEEG 723 RD R +R+ALFDGIEEG Sbjct: 8 RDVRTSRTALFDGIEEG 24 >ref|XP_002307637.1| predicted protein [Populus trichocarpa] gi|222857086|gb|EEE94633.1| predicted protein [Populus trichocarpa] Length = 123 Score = 56.2 bits (134), Expect(2) = 3e-10 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = +3 Query: 720 GGIRAAPSYS-HEIDEQENDRAMDGLQDRVLLLKR 821 GGIRA+ SYS HEIDEQ+N+RA++GLQDRV+LLKR Sbjct: 21 GGIRASSSYSSHEIDEQDNERALEGLQDRVILLKR 55 Score = 35.0 bits (79), Expect(2) = 3e-10 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 673 RDYRNNRSALFDGIEEG 723 RD RNNR+ALFDGIEEG Sbjct: 5 RDIRNNRAALFDGIEEG 21 >gb|ACD62528.1| bet1-like snare 1-1 [Malus x domestica] Length = 122 Score = 57.0 bits (136), Expect(2) = 1e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 720 GGIRAAPSYSHEIDEQENDRAMDGLQDRVLLLKR 821 GGIR++ SYSHEIDE +N+RA+DGLQDRV LLKR Sbjct: 21 GGIRSSASYSHEIDEHDNERAVDGLQDRVNLLKR 54 Score = 32.0 bits (71), Expect(2) = 1e-09 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +1 Query: 673 RDYRNNRSALFDGIEEG 723 RD+R N+ ALFDGIEEG Sbjct: 5 RDFRGNKVALFDGIEEG 21 >ref|XP_002300787.1| predicted protein [Populus trichocarpa] gi|222842513|gb|EEE80060.1| predicted protein [Populus trichocarpa] Length = 123 Score = 53.5 bits (127), Expect(2) = 2e-09 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +3 Query: 720 GGIRAAPSYS-HEIDEQENDRAMDGLQDRVLLLKR 821 GGIRA+ SYS HEIDEQ+N+RA++GL+DRV LLKR Sbjct: 21 GGIRASSSYSSHEIDEQDNERALEGLEDRVSLLKR 55 Score = 35.0 bits (79), Expect(2) = 2e-09 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 673 RDYRNNRSALFDGIEEG 723 RD RNNR+ALFDGIEEG Sbjct: 5 RDVRNNRAALFDGIEEG 21 >ref|XP_002878192.1| ATBS14A [Arabidopsis lyrata subsp. lyrata] gi|297324030|gb|EFH54451.1| ATBS14A [Arabidopsis lyrata subsp. lyrata] Length = 122 Score = 62.4 bits (150), Expect(2) = 2e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 720 GGIRAAPSYSHEIDEQENDRAMDGLQDRVLLLKR 821 GGIRAAPSYSHEI+E EN+RA++GLQDRV+LLKR Sbjct: 21 GGIRAAPSYSHEINEHENERALEGLQDRVILLKR 54 Score = 25.8 bits (55), Expect(2) = 2e-09 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 673 RDYRNNRSALFDGIEEG 723 R+ R RS+LFD IEEG Sbjct: 5 REPRGGRSSLFDAIEEG 21