BLASTX nr result
ID: Papaver23_contig00009959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009959 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282093.2| PREDICTED: probable methyltransferase PMT14-... 70 2e-10 ref|XP_002528760.1| ATP binding protein, putative [Ricinus commu... 65 6e-09 ref|NP_193537.2| putative methyltransferase PMT14 [Arabidopsis t... 64 1e-08 ref|XP_002868016.1| dehydration-responsive family protein [Arabi... 64 1e-08 dbj|BAH19630.1| AT4G18030 [Arabidopsis thaliana] 64 1e-08 >ref|XP_002282093.2| PREDICTED: probable methyltransferase PMT14-like [Vitis vinifera] Length = 611 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 106 MGSKSNPPGNRTRSSLSIFIVIGLCCFFYILGAWQ 2 MGSK NP GNRTRS +SIFIVIGLCCFFYILGAWQ Sbjct: 1 MGSKHNPSGNRTRSPVSIFIVIGLCCFFYILGAWQ 35 >ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis] gi|223531763|gb|EEF33582.1| ATP binding protein, putative [Ricinus communis] Length = 612 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 106 MGSKSNPPGNRTRSSLSIFIVIGLCCFFYILGAWQ 2 MGSK NP GNRTRS LSIFIV LCCFFY+LGAWQ Sbjct: 1 MGSKLNPTGNRTRSPLSIFIVFCLCCFFYVLGAWQ 35 >ref|NP_193537.2| putative methyltransferase PMT14 [Arabidopsis thaliana] gi|75250016|sp|Q94EJ6.1|PMTE_ARATH RecName: Full=Probable methyltransferase PMT14 gi|15294146|gb|AAK95250.1|AF410264_1 AT4g18030/T6K21_210 [Arabidopsis thaliana] gi|24797056|gb|AAN64540.1| At4g18030/T6K21_210 [Arabidopsis thaliana] gi|332658586|gb|AEE83986.1| putative methyltransferase PMT14 [Arabidopsis thaliana] Length = 621 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -1 Query: 106 MGSKSNPPGN-RTRSSLSIFIVIGLCCFFYILGAWQ 2 MGSK NPPGN R+RS+LS+ +V+GLCCFFY+LGAWQ Sbjct: 1 MGSKHNPPGNNRSRSTLSLLVVVGLCCFFYLLGAWQ 36 >ref|XP_002868016.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297313852|gb|EFH44275.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] Length = 624 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -1 Query: 106 MGSKSNPPGN-RTRSSLSIFIVIGLCCFFYILGAWQ 2 MGSK NPPGN R+RS+LS+ +V+GLCCFFY+LGAWQ Sbjct: 1 MGSKHNPPGNNRSRSTLSLLVVVGLCCFFYLLGAWQ 36 >dbj|BAH19630.1| AT4G18030 [Arabidopsis thaliana] Length = 621 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -1 Query: 106 MGSKSNPPGN-RTRSSLSIFIVIGLCCFFYILGAWQ 2 MGSK NPPGN R+RS+LS+ +V+GLCCFFY+LGAWQ Sbjct: 1 MGSKHNPPGNNRSRSTLSLLVVVGLCCFFYLLGAWQ 36