BLASTX nr result
ID: Papaver23_contig00009634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009634 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP33388.1| Mn-specific cation diffusion facilitator transpor... 57 2e-06 ref|XP_003570531.1| PREDICTED: metal tolerance protein 3-like [B... 57 2e-06 gb|ADI24923.1| metal tolerance protein [Carica papaya] 55 6e-06 ref|XP_002299136.1| metal tolerance protein [Populus trichocarpa... 55 6e-06 ref|XP_002275885.1| PREDICTED: metal tolerance protein 4 [Vitis ... 55 8e-06 >gb|AFP33388.1| Mn-specific cation diffusion facilitator transporter MTP8.2 [Hordeum vulgare] Length = 410 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 2 YSIMLSATTVKLFLWFYCRSSPNEIVRAYAK 94 YSIMLSAT VKL LWFYCRSS N IVRAYAK Sbjct: 226 YSIMLSATAVKLALWFYCRSSGNSIVRAYAK 256 >ref|XP_003570531.1| PREDICTED: metal tolerance protein 3-like [Brachypodium distachyon] Length = 406 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 2 YSIMLSATTVKLFLWFYCRSSPNEIVRAYAK 94 YSIMLSAT VKL LWFYCRSS N IVRAYAK Sbjct: 222 YSIMLSATAVKLALWFYCRSSGNSIVRAYAK 252 >gb|ADI24923.1| metal tolerance protein [Carica papaya] Length = 408 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 YSIMLSATTVKLFLWFYCRSSPNEIVRAYAK 94 Y+IML+AT VKL LWFYCRSS N+IVRAYAK Sbjct: 225 YTIMLTATVVKLCLWFYCRSSGNDIVRAYAK 255 >ref|XP_002299136.1| metal tolerance protein [Populus trichocarpa] gi|222846394|gb|EEE83941.1| metal tolerance protein [Populus trichocarpa] Length = 401 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 YSIMLSATTVKLFLWFYCRSSPNEIVRAYAK 94 Y+IMLSAT VKL LW YCRSS NEIVRAYAK Sbjct: 220 YAIMLSATAVKLALWLYCRSSRNEIVRAYAK 250 >ref|XP_002275885.1| PREDICTED: metal tolerance protein 4 [Vitis vinifera] gi|297739814|emb|CBI29996.3| unnamed protein product [Vitis vinifera] Length = 403 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 YSIMLSATTVKLFLWFYCRSSPNEIVRAYAK 94 Y+IML+AT VKL LWFYCRSS N+IVRAYAK Sbjct: 219 YAIMLTATVVKLALWFYCRSSGNKIVRAYAK 249