BLASTX nr result
ID: Papaver23_contig00009482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009482 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFF59215.1| cell division cycle protein 48 [Camellia sinensis] 75 9e-20 ref|XP_002282146.1| PREDICTED: cell division cycle protein 48 ho... 76 9e-20 gb|ACC66148.3| cell division cycle protein [Dimocarpus longan] g... 76 9e-20 ref|XP_001771056.1| predicted protein [Physcomitrella patens sub... 76 2e-19 ref|XP_002465842.1| hypothetical protein SORBIDRAFT_01g046840 [S... 76 2e-19 >gb|AFF59215.1| cell division cycle protein 48 [Camellia sinensis] Length = 807 Score = 75.5 bits (184), Expect(2) = 9e-20 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 188 YFLEAYRLVRKGDLFLVRGGMRSVEFKLIETDPLEYCVV 72 YFLEAYR VRKGDLFLVRGGMRSVEFK+IETDP EYCVV Sbjct: 143 YFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVV 181 Score = 46.2 bits (108), Expect(2) = 9e-20 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 SPDTEIFCEGDTVRRKGEDRLDEV 1 +PDTEIFCEGD VRR+ EDRLDEV Sbjct: 182 APDTEIFCEGDPVRREDEDRLDEV 205 >ref|XP_002282146.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera] gi|297741633|emb|CBI32765.3| unnamed protein product [Vitis vinifera] Length = 806 Score = 76.3 bits (186), Expect(2) = 9e-20 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 188 YFLEAYRLVRKGDLFLVRGGMRSVEFKLIETDPLEYCVV 72 YFLEAYR VRKGDLFLVRGGMRSVEFK+IETDP EYCVV Sbjct: 143 YFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVV 181 Score = 45.4 bits (106), Expect(2) = 9e-20 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 93 PIRVLCCSPDTEIFCEGDTVRRKGEDRLDEV 1 P +PDTEIFCEG+ VRR+ EDRLDEV Sbjct: 175 PAEYCVVAPDTEIFCEGEPVRREDEDRLDEV 205 >gb|ACC66148.3| cell division cycle protein [Dimocarpus longan] gi|221327637|gb|ACM17483.1| cell division cycle protein [Dimocarpus longan] Length = 805 Score = 76.3 bits (186), Expect(2) = 9e-20 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 188 YFLEAYRLVRKGDLFLVRGGMRSVEFKLIETDPLEYCVV 72 YFLEAYR VRKGDLFLVRGGMRSVEFK+IETDP EYCVV Sbjct: 143 YFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVV 181 Score = 45.4 bits (106), Expect(2) = 9e-20 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 93 PIRVLCCSPDTEIFCEGDTVRRKGEDRLDEV 1 P +PDTEIFCEG+ VRR+ EDRLDEV Sbjct: 175 PAEYCVVAPDTEIFCEGEPVRREDEDRLDEV 205 >ref|XP_001771056.1| predicted protein [Physcomitrella patens subsp. patens] gi|162677589|gb|EDQ64057.1| predicted protein [Physcomitrella patens subsp. patens] Length = 820 Score = 76.3 bits (186), Expect(2) = 2e-19 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -2 Query: 188 YFLEAYRLVRKGDLFLVRGGMRSVEFKLIETDPLEYCVV 72 YFLEAYR VRKGDLFLVRGGMRSVEFK++ETDP+EYC+V Sbjct: 155 YFLEAYRPVRKGDLFLVRGGMRSVEFKVVETDPVEYCIV 193 Score = 44.3 bits (103), Expect(2) = 2e-19 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -1 Query: 93 PIRVLCCSPDTEIFCEGDTVRRKGEDRLDEV 1 P+ +PDTEIFCEG+ +RR+ E+RLDEV Sbjct: 187 PVEYCIVAPDTEIFCEGEPLRREDEERLDEV 217 >ref|XP_002465842.1| hypothetical protein SORBIDRAFT_01g046840 [Sorghum bicolor] gi|241919696|gb|EER92840.1| hypothetical protein SORBIDRAFT_01g046840 [Sorghum bicolor] Length = 810 Score = 75.9 bits (185), Expect(2) = 2e-19 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -2 Query: 188 YFLEAYRLVRKGDLFLVRGGMRSVEFKLIETDPLEYCVV 72 YFLEAYR +RKGDLFLVRGGMRSVEFK+IETDP+EYC+V Sbjct: 144 YFLEAYRPLRKGDLFLVRGGMRSVEFKVIETDPIEYCIV 182 Score = 44.7 bits (104), Expect(2) = 2e-19 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -1 Query: 93 PIRVLCCSPDTEIFCEGDTVRRKGEDRLDEV 1 PI +PDTEIFCEG+ V+R+ E+RLDEV Sbjct: 176 PIEYCIVAPDTEIFCEGEPVKREDEERLDEV 206