BLASTX nr result
ID: Papaver23_contig00009403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009403 (552 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278665.1| PREDICTED: probable sodium-coupled neutral a... 81 1e-13 ref|XP_003538492.1| PREDICTED: probable sodium-coupled neutral a... 80 2e-13 ref|XP_002520822.1| amino acid transporter, putative [Ricinus co... 78 1e-12 gb|AFV36700.1| amino acid transporter protein [Glycine max] gi|4... 77 2e-12 ref|XP_003552174.1| PREDICTED: probable sodium-coupled neutral a... 77 2e-12 >ref|XP_002278665.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Vitis vinifera] gi|297736531|emb|CBI25402.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/47 (70%), Positives = 44/47 (93%) Frame = -1 Query: 552 IPNIWYFFQFIGSTTSLCLAFIFPSAIVLRDYHGVATRRDKVLAVLM 412 IPNIWYFFQF+GST+++CLAFIFP+AI LRD HG++TR+D+V+A +M Sbjct: 373 IPNIWYFFQFMGSTSAVCLAFIFPAAITLRDVHGISTRKDRVIATIM 419 >ref|XP_003538492.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Glycine max] Length = 436 Score = 80.1 bits (196), Expect = 2e-13 Identities = 32/47 (68%), Positives = 45/47 (95%) Frame = -1 Query: 552 IPNIWYFFQFIGSTTSLCLAFIFPSAIVLRDYHGVATRRDKVLAVLM 412 IP+IWYFFQF+GS++++CLAFIFP +IVLRD HG++TRRDK++A++M Sbjct: 366 IPDIWYFFQFLGSSSAVCLAFIFPGSIVLRDVHGISTRRDKIIALVM 412 >ref|XP_002520822.1| amino acid transporter, putative [Ricinus communis] gi|223539953|gb|EEF41531.1| amino acid transporter, putative [Ricinus communis] Length = 437 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -1 Query: 552 IPNIWYFFQFIGSTTSLCLAFIFPSAIVLRDYHGVATRRDKVLAVLM 412 IPNIWYFFQF+GSTT++CLAFIFP AIVLRD H ++T +D+++A +M Sbjct: 367 IPNIWYFFQFVGSTTAVCLAFIFPGAIVLRDVHRISTTKDRIVAPIM 413 >gb|AFV36700.1| amino acid transporter protein [Glycine max] gi|409691607|gb|AFV36705.1| amino acid transporter protein [Glycine max] gi|409691624|gb|AFV36716.1| amino acid transporter protein [Glycine max] Length = 436 Score = 77.0 bits (188), Expect = 2e-12 Identities = 31/47 (65%), Positives = 44/47 (93%) Frame = -1 Query: 552 IPNIWYFFQFIGSTTSLCLAFIFPSAIVLRDYHGVATRRDKVLAVLM 412 IP+IWYFFQF+GS++++CLAFIFP +IVLRD G++TRRDK++A++M Sbjct: 366 IPDIWYFFQFLGSSSAVCLAFIFPGSIVLRDVKGISTRRDKIIALIM 412 >ref|XP_003552174.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Glycine max] Length = 184 Score = 77.0 bits (188), Expect = 2e-12 Identities = 31/47 (65%), Positives = 44/47 (93%) Frame = -1 Query: 552 IPNIWYFFQFIGSTTSLCLAFIFPSAIVLRDYHGVATRRDKVLAVLM 412 IP+IWYFFQF+GS++++CLAFIFP +IVLRD G++TRRDK++A++M Sbjct: 114 IPDIWYFFQFLGSSSAVCLAFIFPGSIVLRDVKGISTRRDKIIALIM 160