BLASTX nr result
ID: Papaver23_contig00009289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009289 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531183.1| PREDICTED: cyclin-dependent kinase G-2-like ... 50 6e-13 ref|XP_003601812.1| Cyclin dependent kinase [Medicago truncatula... 52 8e-13 ref|XP_002514988.1| cdk10/11, putative [Ricinus communis] gi|223... 50 8e-13 ref|XP_003524883.1| PREDICTED: cyclin-dependent kinase G-2-like ... 50 1e-12 emb|CBI27558.3| unnamed protein product [Vitis vinifera] 50 3e-12 >ref|XP_003531183.1| PREDICTED: cyclin-dependent kinase G-2-like [Glycine max] Length = 745 Score = 50.4 bits (119), Expect(2) = 6e-13 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 44 RYNLLRKKFPHRAFTGSLVLSDARFDLLNRLL 139 +YNLLRKKFP +FTGS VLSD+ FDLLN+LL Sbjct: 640 QYNLLRKKFPATSFTGSPVLSDSGFDLLNKLL 671 Score = 48.1 bits (113), Expect(2) = 6e-13 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +1 Query: 139 TYDPAKRITAEEAVNHEWFREVLFP 213 TYDP KRITAE+A+NHEWFREV P Sbjct: 672 TYDPEKRITAEDALNHEWFREVPLP 696 >ref|XP_003601812.1| Cyclin dependent kinase [Medicago truncatula] gi|355490860|gb|AES72063.1| Cyclin dependent kinase [Medicago truncatula] Length = 841 Score = 52.4 bits (124), Expect(2) = 8e-13 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 41 FRYNLLRKKFPHRAFTGSLVLSDARFDLLNRLL 139 FRYNLLRKKFP +FTGS VLSD+ FDLL++LL Sbjct: 670 FRYNLLRKKFPATSFTGSPVLSDSGFDLLSKLL 702 Score = 45.8 bits (107), Expect(2) = 8e-13 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +1 Query: 139 TYDPAKRITAEEAVNHEWFREVLFP 213 TYDP KRITAE+A+NH WFREV P Sbjct: 703 TYDPEKRITAEDALNHAWFREVPLP 727 >ref|XP_002514988.1| cdk10/11, putative [Ricinus communis] gi|223546039|gb|EEF47542.1| cdk10/11, putative [Ricinus communis] Length = 754 Score = 50.4 bits (119), Expect(2) = 8e-13 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 44 RYNLLRKKFPHRAFTGSLVLSDARFDLLNRLL 139 +YNLLRKKFP +FTGS VLSD+ FDLLN+LL Sbjct: 649 QYNLLRKKFPATSFTGSPVLSDSGFDLLNKLL 680 Score = 47.8 bits (112), Expect(2) = 8e-13 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 139 TYDPAKRITAEEAVNHEWFREVLFP 213 TYDP KRITAE A+NHEWFREV P Sbjct: 681 TYDPEKRITAEAAINHEWFREVPLP 705 >ref|XP_003524883.1| PREDICTED: cyclin-dependent kinase G-2-like [Glycine max] Length = 746 Score = 50.4 bits (119), Expect(2) = 1e-12 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 44 RYNLLRKKFPHRAFTGSLVLSDARFDLLNRLL 139 +YNLLRKKFP +FTGS VLSD+ FDLLN+LL Sbjct: 641 QYNLLRKKFPATSFTGSPVLSDSGFDLLNKLL 672 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 139 TYDPAKRITAEEAVNHEWFREVLFP 213 TYDP KRITAE A+NHEWFREV P Sbjct: 673 TYDPEKRITAEAALNHEWFREVPLP 697 >emb|CBI27558.3| unnamed protein product [Vitis vinifera] Length = 774 Score = 50.4 bits (119), Expect(2) = 3e-12 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 44 RYNLLRKKFPHRAFTGSLVLSDARFDLLNRLL 139 +YNLLRKKFP +FTGS VLSD+ FDLLN+LL Sbjct: 669 QYNLLRKKFPATSFTGSPVLSDSGFDLLNKLL 700 Score = 45.8 bits (107), Expect(2) = 3e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +1 Query: 139 TYDPAKRITAEEAVNHEWFREVLFP 213 TYDP KRITAE A+NH+WFREV P Sbjct: 701 TYDPEKRITAEAALNHDWFREVPLP 725