BLASTX nr result
ID: Papaver23_contig00009284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009284 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB87117.1| unknown [Solanum tuberosum] 73 3e-11 gb|ABA40470.1| ribosomal protein S6-like protein [Solanum tubero... 73 3e-11 emb|CAA09042.1| 40S ribosomal protein S6 [Cicer arietinum] 73 3e-11 ref|XP_002525831.1| 40S ribosomal protein S6, putative [Ricinus ... 72 6e-11 ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 71 8e-11 >gb|ABB87117.1| unknown [Solanum tuberosum] Length = 249 Score = 72.8 bits (177), Expect = 3e-11 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +3 Query: 3 RLVTPLTLQXXXXXXXXXXXXXXXXXXXXXDYQKLLASRLKEQRDRRSESLAKKRSRLSA 182 RLVTPLTLQ DYQKLLASRLKEQR+RRSESLAKKRSRLSA Sbjct: 182 RLVTPLTLQRKRARIADKKKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSA 241 Query: 183 ATKPA 197 A+KP+ Sbjct: 242 ASKPS 246 >gb|ABA40470.1| ribosomal protein S6-like protein [Solanum tuberosum] Length = 249 Score = 72.8 bits (177), Expect = 3e-11 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +3 Query: 3 RLVTPLTLQXXXXXXXXXXXXXXXXXXXXXDYQKLLASRLKEQRDRRSESLAKKRSRLSA 182 RLVTPLTLQ DYQKLLASRLKEQR+RRSESLAKKRSRLSA Sbjct: 182 RLVTPLTLQRKRARIADKKKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSA 241 Query: 183 ATKPA 197 A+KP+ Sbjct: 242 ASKPS 246 >emb|CAA09042.1| 40S ribosomal protein S6 [Cicer arietinum] Length = 212 Score = 72.8 bits (177), Expect = 3e-11 Identities = 41/66 (62%), Positives = 44/66 (66%) Frame = +3 Query: 3 RLVTPLTLQXXXXXXXXXXXXXXXXXXXXXDYQKLLASRLKEQRDRRSESLAKKRSRLSA 182 RLVTPLTLQ +YQKLLASRLKEQR+RRSESLAKKRSRLS+ Sbjct: 145 RLVTPLTLQRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSS 204 Query: 183 ATKPAA 200 ATKP A Sbjct: 205 ATKPTA 210 >ref|XP_002525831.1| 40S ribosomal protein S6, putative [Ricinus communis] gi|223534836|gb|EEF36525.1| 40S ribosomal protein S6, putative [Ricinus communis] Length = 197 Score = 71.6 bits (174), Expect = 6e-11 Identities = 40/65 (61%), Positives = 44/65 (67%) Frame = +3 Query: 3 RLVTPLTLQXXXXXXXXXXXXXXXXXXXXXDYQKLLASRLKEQRDRRSESLAKKRSRLSA 182 RLVTPLTLQ DYQKLLA+RLKEQR+RRSESLAKKRSRLSA Sbjct: 130 RLVTPLTLQRKRARIAQKKQRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSA 189 Query: 183 ATKPA 197 A+KP+ Sbjct: 190 ASKPS 194 >ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] gi|449477988|ref|XP_004155185.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] Length = 250 Score = 71.2 bits (173), Expect = 8e-11 Identities = 40/65 (61%), Positives = 44/65 (67%) Frame = +3 Query: 3 RLVTPLTLQXXXXXXXXXXXXXXXXXXXXXDYQKLLASRLKEQRDRRSESLAKKRSRLSA 182 RLVTPLTLQ +YQKLLASRLKEQR+RRSESLAKKRSRLSA Sbjct: 182 RLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSA 241 Query: 183 ATKPA 197 A+KP+ Sbjct: 242 ASKPS 246