BLASTX nr result
ID: Papaver23_contig00009189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00009189 (511 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635119.1| PREDICTED: uncharacterized protein LOC100248... 60 1e-07 ref|XP_002320545.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002524568.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_003635119.1| PREDICTED: uncharacterized protein LOC100248340 [Vitis vinifera] gi|297736665|emb|CBI25682.3| unnamed protein product [Vitis vinifera] Length = 158 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 509 WEAAMHAFNDPPLDLTERPVMYSGTGALTWGQGQVQARPPQQMDFLAELRR 357 W AAMH N+ LDL ERPVMYSG+GA WG ++ P Q MDF ELRR Sbjct: 101 WAAAMHGCNNQSLDLPERPVMYSGSGASAWGHFRL---PHQMMDFSGELRR 148 >ref|XP_002320545.1| predicted protein [Populus trichocarpa] gi|222861318|gb|EEE98860.1| predicted protein [Populus trichocarpa] Length = 180 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/61 (45%), Positives = 36/61 (59%), Gaps = 10/61 (16%) Frame = -3 Query: 509 WEAAMHAFNDPPLDLTERPVMYSGTGALTWGQGQVQ----------ARPPQQMDFLAELR 360 W A MH++ND +DL+ERPVMYSG+ WGQ ++ P QMDFL+EL Sbjct: 109 WAAIMHSYNDTAIDLSERPVMYSGSSPPAWGQFKLPHQVMSPVNSVGAPNPQMDFLSELH 168 Query: 359 R 357 R Sbjct: 169 R 169 >ref|XP_002524568.1| conserved hypothetical protein [Ricinus communis] gi|223536121|gb|EEF37776.1| conserved hypothetical protein [Ricinus communis] Length = 172 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 10/61 (16%) Frame = -3 Query: 509 WEAAMHAFNDPPLDLTERPVMYSGTGALTWGQG--------QVQARPP--QQMDFLAELR 360 W AMH +ND +DL+ERP MYSG+ A WG Q + P QMDFL+ELR Sbjct: 101 WAQAMHNYNDTSVDLSERPAMYSGSSASAWGHSRLPHQFMLQANSGPSSGSQMDFLSELR 160 Query: 359 R 357 R Sbjct: 161 R 161