BLASTX nr result
ID: Papaver23_contig00008669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00008669 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328401.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002526240.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002328401.1| predicted protein [Populus trichocarpa] gi|222838116|gb|EEE76481.1| predicted protein [Populus trichocarpa] Length = 449 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = -3 Query: 159 GNNVDLFTQILLCLSVKPLLVFKSVSKQWFSAKSDPLFIKQHT 31 GNN+DL T+ILL + KPLL FK VSKQW S SDP F HT Sbjct: 90 GNNLDLVTEILLRVPAKPLLKFKCVSKQWLSLISDPKFCASHT 132 >ref|XP_002526240.1| conserved hypothetical protein [Ricinus communis] gi|223534434|gb|EEF36137.1| conserved hypothetical protein [Ricinus communis] Length = 393 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -3 Query: 159 GNNVDLFTQILLCLSVKPLLVFKSVSKQWFSAKSDPLFIKQHTV 28 G+N DL TQILL L VKPLL FKSVSKQW S S P F HT+ Sbjct: 11 GSNEDLITQILLRLPVKPLLRFKSVSKQWLSLISTPHFSSLHTL 54