BLASTX nr result
ID: Papaver23_contig00007547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00007547 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC86706.1| non-race specific disease resistance protein 1-li... 72 6e-11 gb|ABC86707.1| non-race specific disease resistance protein 1-li... 72 6e-11 ref|NP_188696.1| late embryogenesis abundant hydroxyproline-rich... 58 9e-07 gb|ABR45921.1| non-race specific disease resistance 1 [Arabidops... 58 9e-07 ref|XP_004158486.1| PREDICTED: protein NDR1-like [Cucumis sativus] 57 1e-06 >gb|ABC86706.1| non-race specific disease resistance protein 1-like protein a [Coffea arabica] Length = 214 Score = 71.6 bits (174), Expect = 6e-11 Identities = 39/109 (35%), Positives = 58/109 (53%) Frame = -2 Query: 466 YDTVNMNLYYHGSNSVLAIGNTSIPEFDQGNSWPTLRVETIQTHGVPWEDVRTEILKGNE 287 YD +N+ +Y N L I N ++P F QG+ R E +QT+GVPWE + G+ Sbjct: 82 YDDLNLTFFYV-QNGSLGIANYTVPSFYQGHDKKARRKELVQTYGVPWEAAYRAVSNGST 140 Query: 286 AAFWLDLHTSYRSSNESWFVKSRRYDLRIGANVTVNGHGLKSVKQRLKM 140 F + L T R W+ K R+ L++GANV VN G K K+ +++ Sbjct: 141 VTFRVGLTTRVRYKILFWYTK--RHGLKVGANVDVNNSGKKVNKKGIRL 187 >gb|ABC86707.1| non-race specific disease resistance protein 1-like protein b [Coffea arabica] Length = 214 Score = 71.6 bits (174), Expect = 6e-11 Identities = 39/109 (35%), Positives = 58/109 (53%) Frame = -2 Query: 466 YDTVNMNLYYHGSNSVLAIGNTSIPEFDQGNSWPTLRVETIQTHGVPWEDVRTEILKGNE 287 YD +N+ +Y N L I N ++P F QG+ R E +QT+GVPWE + G+ Sbjct: 82 YDDLNLTFFYV-QNGSLGIANYTVPSFYQGHDKKARRKELVQTYGVPWEAAYRAVSNGST 140 Query: 286 AAFWLDLHTSYRSSNESWFVKSRRYDLRIGANVTVNGHGLKSVKQRLKM 140 F + L T R W+ K R+ L++GANV VN G K K+ +++ Sbjct: 141 VTFRVGLTTRVRYKILFWYTK--RHGLKVGANVDVNNSGKKVNKKGIRL 187 >ref|NP_188696.1| late embryogenesis abundant hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|75274971|sp|O48915.1|NDR1_ARATH RecName: Full=Protein NDR1; AltName: Full=Non-race specific disease resistance protein 1; Short=AtNDR1; Flags: Precursor gi|2754816|gb|AAB95208.1| non-race specific disease resistance protein [Arabidopsis thaliana] gi|11994147|dbj|BAB01168.1| non-race specific disease resistance protein [Arabidopsis thaliana] gi|25082922|gb|AAN72015.1| non-race specific disease resistance protein (NDR1) [Arabidopsis thaliana] gi|30023684|gb|AAP13375.1| At3g20600 [Arabidopsis thaliana] gi|149939437|gb|ABR45925.1| non-race specific disease resistance 1 [Arabidopsis thaliana] gi|149939439|gb|ABR45926.1| non-race specific disease resistance 1 [Arabidopsis thaliana] gi|149939453|gb|ABR45933.1| non-race specific disease resistance 1 [Arabidopsis thaliana] gi|149939457|gb|ABR45935.1| non-race specific disease resistance 1 [Arabidopsis thaliana] gi|332642881|gb|AEE76402.1| late embryogenesis abundant hydroxyproline-rich glycoprotein [Arabidopsis thaliana] Length = 219 Score = 57.8 bits (138), Expect = 9e-07 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 10/121 (8%) Frame = -2 Query: 472 IFYDTVNMNLYYHG-----SNSVLAIGNTSIPEFDQGNS-----WPTLRVETIQTHGVPW 323 I+YD V++N S++++ +GN ++P+F QG+ W ++ QT Sbjct: 80 IYYDDVHLNFSTINTTKINSSALVLVGNYTVPKFYQGHKKKAKKWGQVKPLNNQT----- 134 Query: 322 EDVRTEILKGNEAAFWLDLHTSYRSSNESWFVKSRRYDLRIGANVTVNGHGLKSVKQRLK 143 V +L A F LDL T R W K++RY + +GA+V VNG G+K+ K+ +K Sbjct: 135 --VLRAVLPNGSAVFRLDLKTQVRFKIVFW--KTKRYGVEVGADVEVNGDGVKAQKKGIK 190 Query: 142 M 140 M Sbjct: 191 M 191 >gb|ABR45921.1| non-race specific disease resistance 1 [Arabidopsis thaliana] Length = 219 Score = 57.8 bits (138), Expect = 9e-07 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 10/121 (8%) Frame = -2 Query: 472 IFYDTVNMNLYYHG-----SNSVLAIGNTSIPEFDQGNS-----WPTLRVETIQTHGVPW 323 I+YD V++N S++++ +GN ++P+F QG+ W ++ QT Sbjct: 80 IYYDDVHLNFSTINTTKINSSALVLVGNYTVPKFYQGHKKKAKKWGQVKPLNNQT----- 134 Query: 322 EDVRTEILKGNEAAFWLDLHTSYRSSNESWFVKSRRYDLRIGANVTVNGHGLKSVKQRLK 143 V +L A F LDL T R W K++RY + +GA+V VNG G+K+ K+ +K Sbjct: 135 --VLRAVLPNGSAVFRLDLKTQVRFKIVFW--KTKRYGVEVGADVEVNGDGVKAQKKGIK 190 Query: 142 M 140 M Sbjct: 191 M 191 >ref|XP_004158486.1| PREDICTED: protein NDR1-like [Cucumis sativus] Length = 213 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/106 (33%), Positives = 53/106 (50%) Frame = -2 Query: 481 QPQIFYDTVNMNLYYHGSNSVLAIGNTSIPEFDQGNSWPTLRVETIQTHGVPWEDVRTEI 302 + ++YDT+ +NL L +GN ++P F QG LR E+ + GV W+ V Sbjct: 70 EKSVYYDTIYLNLTLLDETRRL-VGNLTVPGFHQGRDKKALRKESFEARGVDWKAVS--- 125 Query: 301 LKGNEAAFWLDLHTSYRSSNESWFVKSRRYDLRIGANVTVNGHGLK 164 + LDL T+ R W K++R +LR+G V VN G+K Sbjct: 126 -RNGSTVIRLDLATAVRYKILLW--KTKRENLRLGTEVKVNEQGVK 168