BLASTX nr result
ID: Papaver23_contig00007462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00007462 (893 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK45175.1| unknown [Lotus japonicus] 71 3e-10 tpg|DAA57368.1| TPA: putative cytochrome P450 superfamily protei... 70 7e-10 gb|ACG35298.1| transmembrane protein 49 [Zea mays] 70 7e-10 ref|NP_001140432.1| uncharacterized protein LOC100272491 [Zea ma... 70 7e-10 ref|XP_003610704.1| Transmembrane protein [Medicago truncatula] ... 70 9e-10 >gb|AFK45175.1| unknown [Lotus japonicus] Length = 412 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = +1 Query: 22 LRVSYLEIYNEVQKWWNLSITSVWNTVVWLLLFNFFIKIVNSTAQRYVKKQHDSERRGS 198 L+ S+ N K W+ SI SVWNTVVWL+L NFF+KIVNSTAQ YVKKQ + E S Sbjct: 352 LKASHPVSPNIQGKKWDFSIASVWNTVVWLMLMNFFVKIVNSTAQSYVKKQQEKELAAS 410 >tpg|DAA57368.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 382 Score = 70.1 bits (170), Expect = 7e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 58 QKWWNLSITSVWNTVVWLLLFNFFIKIVNSTAQRYVKKQHDSE 186 +K WN S TSVWN++VWL+L NFFIKIV STAQ Y+KKQ D+E Sbjct: 324 EKQWNFSFTSVWNSIVWLVLLNFFIKIVTSTAQDYLKKQQDTE 366 >gb|ACG35298.1| transmembrane protein 49 [Zea mays] Length = 436 Score = 70.1 bits (170), Expect = 7e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 58 QKWWNLSITSVWNTVVWLLLFNFFIKIVNSTAQRYVKKQHDSE 186 +K WN S TSVWN++VWL+L NFFIKIV STAQ Y+KKQ D+E Sbjct: 378 EKQWNFSFTSVWNSIVWLVLLNFFIKIVTSTAQDYLKKQQDTE 420 >ref|NP_001140432.1| uncharacterized protein LOC100272491 [Zea mays] gi|194699484|gb|ACF83826.1| unknown [Zea mays] gi|414880239|tpg|DAA57370.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 436 Score = 70.1 bits (170), Expect = 7e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 58 QKWWNLSITSVWNTVVWLLLFNFFIKIVNSTAQRYVKKQHDSE 186 +K WN S TSVWN++VWL+L NFFIKIV STAQ Y+KKQ D+E Sbjct: 378 EKQWNFSFTSVWNSIVWLVLLNFFIKIVTSTAQDYLKKQQDTE 420 >ref|XP_003610704.1| Transmembrane protein [Medicago truncatula] gi|217074688|gb|ACJ85704.1| unknown [Medicago truncatula] gi|355512039|gb|AES93662.1| Transmembrane protein [Medicago truncatula] gi|388502006|gb|AFK39069.1| unknown [Medicago truncatula] Length = 417 Score = 69.7 bits (169), Expect = 9e-10 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +1 Query: 49 NEVQKWWNLSITSVWNTVVWLLLFNFFIKIVNSTAQRYVKKQHDSE 186 N K W+ S TS+WNTVVWL+L NFFIKIVNSTAQ ++KKQ +SE Sbjct: 359 NTKGKKWDFSFTSIWNTVVWLMLMNFFIKIVNSTAQTHLKKQQESE 404