BLASTX nr result
ID: Papaver23_contig00005749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00005749 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273627.2| PREDICTED: diphthamide biosynthesis protein ... 60 2e-07 ref|XP_002530564.1| diphteria toxin resistance protein 2, dph2, ... 57 2e-06 >ref|XP_002273627.2| PREDICTED: diphthamide biosynthesis protein 2-like [Vitis vinifera] gi|296084273|emb|CBI24661.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 417 KALQLHEKYPKSIIKGSANSGAEFFSSRSYQGLEMQTDDSVP 292 KALQ+ +K+P S+IKG+A SG EFF++RSY GLEM ++DS P Sbjct: 442 KALQVRDKHPNSLIKGTAKSGGEFFAARSYHGLEMHSNDSSP 483 >ref|XP_002530564.1| diphteria toxin resistance protein 2, dph2, putative [Ricinus communis] gi|223529863|gb|EEF31794.1| diphteria toxin resistance protein 2, dph2, putative [Ricinus communis] Length = 499 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -3 Query: 417 KALQLHEKYPKSIIKGSANSGAEFFSSRSYQGLEMQTDDSVP 292 KALQLH++ S+IKG+ SGAE+F++RSYQGLEM D+S P Sbjct: 437 KALQLHDRNSTSLIKGTIKSGAEYFANRSYQGLEMHGDNSKP 478