BLASTX nr result
ID: Papaver23_contig00005599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00005599 (1057 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304655.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-08 ref|XP_003614127.1| hypothetical protein MTR_5g045160 [Medicago ... 64 8e-08 emb|CAN80555.1| hypothetical protein VITISV_012515 [Vitis vinifera] 61 5e-07 ref|XP_002863658.1| hypothetical protein ARALYDRAFT_917317 [Arab... 60 7e-07 ref|XP_002531538.1| conserved hypothetical protein [Ricinus comm... 60 9e-07 >ref|XP_002304655.1| predicted protein [Populus trichocarpa] gi|222842087|gb|EEE79634.1| predicted protein [Populus trichocarpa] Length = 651 Score = 64.7 bits (156), Expect = 4e-08 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = +2 Query: 551 NDTVTTTMFFQWSVFEAHDEERFNQYLESVKKGETKIAAGALLPHEIIASLDD 709 N + M F F HD ERF QYLE VK G+TKIAAGALLPHEII SL+D Sbjct: 373 NRVASVAMKFYKKKFFKHDAERFRQYLEDVKAGKTKIAAGALLPHEIIESLND 425 >ref|XP_003614127.1| hypothetical protein MTR_5g045160 [Medicago truncatula] gi|355515462|gb|AES97085.1| hypothetical protein MTR_5g045160 [Medicago truncatula] Length = 729 Score = 63.5 bits (153), Expect = 8e-08 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = +2 Query: 551 NDTVTTTMFFQWSVFEAHDEERFNQYLESVKKGETKIAAGALLPHEIIASLDD 709 N + M F F HD+ERF +YLE VK G+T IAAGALLPHEII SLDD Sbjct: 386 NRVASVAMKFYKEKFLKHDKERFEKYLEDVKAGKTTIAAGALLPHEIIESLDD 438 >emb|CAN80555.1| hypothetical protein VITISV_012515 [Vitis vinifera] Length = 509 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +2 Query: 587 SVFEAHDEERFNQYLESVKKGETKIAAGALLPHEIIASLDD 709 S+F HD ERF +YLE V+ G+ KIAAGALLPHEIIASL++ Sbjct: 6 SLFSKHDTERFGEYLEKVQTGKAKIAAGALLPHEIIASLNE 46 >ref|XP_002863658.1| hypothetical protein ARALYDRAFT_917317 [Arabidopsis lyrata subsp. lyrata] gi|297309493|gb|EFH39917.1| hypothetical protein ARALYDRAFT_917317 [Arabidopsis lyrata subsp. lyrata] Length = 657 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +2 Query: 590 VFEAHDEERFNQYLESVKKGETKIAAGALLPHEIIASLDD 709 +FE HD ERF+Q+LE VK G+ KIAAGALLPH+II L+D Sbjct: 365 LFEEHDSERFSQFLEDVKSGKKKIAAGALLPHQIIKQLED 404 >ref|XP_002531538.1| conserved hypothetical protein [Ricinus communis] gi|223528855|gb|EEF30857.1| conserved hypothetical protein [Ricinus communis] Length = 663 Score = 60.1 bits (144), Expect = 9e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 587 SVFEAHDEERFNQYLESVKKGETKIAAGALLPHEIIASLDD 709 ++F HDEERF +YL++VK G+ KIAAGALLPHEII +L D Sbjct: 372 ALFLKHDEERFEEYLDNVKSGKAKIAAGALLPHEIIGALKD 412