BLASTX nr result
ID: Papaver23_contig00005385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00005385 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522896.1| conserved hypothetical protein [Ricinus comm... 102 3e-20 ref|XP_002307908.1| predicted protein [Populus trichocarpa] gi|2... 102 3e-20 ref|XP_003594272.1| hypothetical protein MTR_2g026420 [Medicago ... 101 6e-20 ref|XP_002522765.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 ref|XP_002438477.1| hypothetical protein SORBIDRAFT_10g020170 [S... 93 3e-17 >ref|XP_002522896.1| conserved hypothetical protein [Ricinus communis] gi|223537881|gb|EEF39496.1| conserved hypothetical protein [Ricinus communis] Length = 117 Score = 102 bits (254), Expect = 3e-20 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -3 Query: 431 FQMPLHYPRYKKSDYEKMEEWKVDMLLREYGLDSFKGTLDEKREFAMGTFLWPDQ 267 FQ+PLHYPRY K+DY+KMEEW+VDMLLREYGL S KGTL+EKR FAMGTFLWPDQ Sbjct: 63 FQLPLHYPRYTKTDYQKMEEWRVDMLLREYGL-SIKGTLEEKRAFAMGTFLWPDQ 116 >ref|XP_002307908.1| predicted protein [Populus trichocarpa] gi|222853884|gb|EEE91431.1| predicted protein [Populus trichocarpa] Length = 61 Score = 102 bits (254), Expect = 3e-20 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -3 Query: 431 FQMPLHYPRYKKSDYEKMEEWKVDMLLREYGLDSFKGTLDEKREFAMGTFLWPDQ 267 FQMPLHYPRY K+DYEKMEEWKVDMLLREYG+ SFKG L+EKR +AMG FLWPDQ Sbjct: 7 FQMPLHYPRYAKADYEKMEEWKVDMLLREYGI-SFKGNLEEKRAYAMGAFLWPDQ 60 >ref|XP_003594272.1| hypothetical protein MTR_2g026420 [Medicago truncatula] gi|355483320|gb|AES64523.1| hypothetical protein MTR_2g026420 [Medicago truncatula] Length = 108 Score = 101 bits (252), Expect = 6e-20 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -3 Query: 431 FQMPLHYPRYKKSDYEKMEEWKVDMLLREYGLDSFKGTLDEKREFAMGTFLWPDQ 267 FQMPLHYPRY K DYEKMEEWKV++LL+EYGL SFKG+LDEKR FAMG FLWPDQ Sbjct: 54 FQMPLHYPRYTKVDYEKMEEWKVELLLKEYGL-SFKGSLDEKRSFAMGAFLWPDQ 107 >ref|XP_002522765.1| conserved hypothetical protein [Ricinus communis] gi|223538003|gb|EEF39616.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 99.8 bits (247), Expect = 2e-19 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -3 Query: 431 FQMPLHYPRYKKSDYEKMEEWKVDMLLREYGLDSFKGTLDEKREFAMGTFLWPDQ 267 FQ+PLHYPRY K+DYEKME+W++DMLL EYGL FKGTLDEKR FAMG+FLWPDQ Sbjct: 60 FQVPLHYPRYSKADYEKMEDWRLDMLLNEYGL-CFKGTLDEKRAFAMGSFLWPDQ 113 >ref|XP_002438477.1| hypothetical protein SORBIDRAFT_10g020170 [Sorghum bicolor] gi|241916700|gb|EER89844.1| hypothetical protein SORBIDRAFT_10g020170 [Sorghum bicolor] Length = 103 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/55 (76%), Positives = 46/55 (83%) Frame = -3 Query: 431 FQMPLHYPRYKKSDYEKMEEWKVDMLLREYGLDSFKGTLDEKREFAMGTFLWPDQ 267 FQMPLHYPRYKK+DYE M EW+VD LLREYGL + G LD KR+FAMG FLWPDQ Sbjct: 49 FQMPLHYPRYKKADYESMPEWRVDCLLREYGLPA-DGDLDSKRKFAMGAFLWPDQ 102