BLASTX nr result
ID: Papaver23_contig00005184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00005184 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634844.1| PREDICTED: transcription factor bHLH74-like ... 56 3e-06 >ref|XP_003634844.1| PREDICTED: transcription factor bHLH74-like [Vitis vinifera] gi|296090643|emb|CBI41042.3| unnamed protein product [Vitis vinifera] Length = 415 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 3/85 (3%) Frame = -1 Query: 494 LHSSLG--AALHGFGPGATSSLH-PSLNPLGTMPALQCTTPQLSNMSQVPPNTWEDELQS 324 +H S G A + GFGPG S+ P + PA++ +T Q S MS +P N W++ELQ Sbjct: 332 IHHSKGGTAPILGFGPGMNSAYPIPQVTLQAISPAIESSTLQSSPMSPMP-NVWDNELQG 390 Query: 323 MIQMGLISNQALENMGLNGHMKVEL 249 + QMG S LEN+ +G KV+L Sbjct: 391 IKQMGFTSTADLENLETSGCTKVQL 415