BLASTX nr result
ID: Papaver23_contig00004974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00004974 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534522.1| PREDICTED: CBS domain-containing protein CBS... 60 1e-07 ref|XP_002512622.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_004152831.1| PREDICTED: CBS domain-containing protein CBS... 59 4e-07 ref|XP_003552437.1| PREDICTED: CBS domain-containing protein CBS... 59 4e-07 gb|AAC27143.1|AAC27143 T8F5.10 [Arabidopsis thaliana] 59 5e-07 >ref|XP_003534522.1| PREDICTED: CBS domain-containing protein CBSX6-like [Glycine max] Length = 425 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 3 LSHRTAHVWVTEADSEDDHDETLVGVIGYTDILAAVTRHPAAF 131 LSHR HVWVTE D++DE LVGV+GY DILAAVT+ P AF Sbjct: 371 LSHRATHVWVTE----DENDEVLVGVVGYADILAAVTKPPTAF 409 >ref|XP_002512622.1| conserved hypothetical protein [Ricinus communis] gi|223548583|gb|EEF50074.1| conserved hypothetical protein [Ricinus communis] Length = 432 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 3 LSHRTAHVWVTEADSEDDHDETLVGVIGYTDILAAVTRHPAAF 131 LSHR HVWVTEAD+ DE LVGV+GY DIL AVT+ PA+F Sbjct: 378 LSHRATHVWVTEADN----DEVLVGVVGYADILFAVTKPPASF 416 >ref|XP_004152831.1| PREDICTED: CBS domain-containing protein CBSX6-like [Cucumis sativus] gi|449477694|ref|XP_004155096.1| PREDICTED: CBS domain-containing protein CBSX6-like isoform 1 [Cucumis sativus] gi|449477697|ref|XP_004155097.1| PREDICTED: CBS domain-containing protein CBSX6-like isoform 2 [Cucumis sativus] Length = 425 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 3 LSHRTAHVWVTEADSEDDHDETLVGVIGYTDILAAVTRHPAAF 131 LSHR +HVWVTE D++D+ LVGV+GY DILAAVT+ P +F Sbjct: 371 LSHRASHVWVTE----DENDDILVGVVGYADILAAVTKQPTSF 409 >ref|XP_003552437.1| PREDICTED: CBS domain-containing protein CBSX6-like [Glycine max] Length = 425 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 3 LSHRTAHVWVTEADSEDDHDETLVGVIGYTDILAAVTRHPAAF 131 LSHR HVWVTE D++DE LVGV+GY DILAAVT+ P F Sbjct: 371 LSHRATHVWVTE----DENDEVLVGVVGYADILAAVTKPPTTF 409 >gb|AAC27143.1|AAC27143 T8F5.10 [Arabidopsis thaliana] Length = 482 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 3 LSHRTAHVWVTEADSEDDHDETLVGVIGYTDILAAVTRHPAAF 131 LSHR HVWVTEADS+D LVGV+GY +IL AVT+ P+AF Sbjct: 428 LSHRATHVWVTEADSDD----VLVGVVGYGEILTAVTKQPSAF 466