BLASTX nr result
ID: Papaver23_contig00001967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00001967 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_182095.1| 40S ribosomal protein S27-1 [Arabidopsis thalia... 65 6e-09 ref|NP_191670.1| 40S ribosomal protein S27-2 [Arabidopsis thalia... 65 6e-09 dbj|BAJ34536.1| unnamed protein product [Thellungiella halophila] 65 6e-09 gb|ADN33695.1| 40S ribosomal protein s27 [Cucumis melo subsp. melo] 65 6e-09 ref|XP_002880192.1| predicted protein [Arabidopsis lyrata subsp.... 65 6e-09 >ref|NP_182095.1| 40S ribosomal protein S27-1 [Arabidopsis thaliana] gi|73917952|sp|O64650.1|RS271_ARATH RecName: Full=40S ribosomal protein S27-1 gi|3386624|gb|AAC28554.1| putative ribosomal protein S27 [Arabidopsis thaliana] gi|18252883|gb|AAL62368.1| putative ribosomal protein S27 [Arabidopsis thaliana] gi|20197050|gb|AAM14895.1| putative ribosomal protein S27 [Arabidopsis thaliana] gi|21553959|gb|AAM63040.1| putative ribosomal protein S27 [Arabidopsis thaliana] gi|23197762|gb|AAN15408.1| putative ribosomal protein S27 [Arabidopsis thaliana] gi|110736239|dbj|BAF00090.1| 40S ribosomal protein S27 [Arabidopsis thaliana] gi|330255496|gb|AEC10590.1| 40S ribosomal protein S27-1 [Arabidopsis thaliana] Length = 84 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 437 MVLSNDIDLLNPPADLEKRRHKLKRLVQSPNSF 339 MVL NDIDLLNPPA+LEKR+HKLKRLVQSPNSF Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSF 33 >ref|NP_191670.1| 40S ribosomal protein S27-2 [Arabidopsis thaliana] gi|73917991|sp|Q9M2F1.2|RS272_ARATH RecName: Full=40S ribosomal protein S27-2 gi|15724226|gb|AAL06506.1|AF412053_1 AT3g61110/T27I15_200 [Arabidopsis thaliana] gi|4193382|gb|AAD10029.1| ribosomal protein S27 [Arabidopsis thaliana] gi|4193384|gb|AAD10030.1| ribosomal protein S27 [Arabidopsis thaliana] gi|8388627|emb|CAB94147.1| ribosomal protein S27 [Arabidopsis thaliana] gi|19699108|gb|AAL90920.1| AT3g61110/T27I15_200 [Arabidopsis thaliana] gi|332646633|gb|AEE80154.1| 40S ribosomal protein S27-2 [Arabidopsis thaliana] Length = 86 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 437 MVLSNDIDLLNPPADLEKRRHKLKRLVQSPNSF 339 MVL NDIDLLNPPA+LEKR+HKLKRLVQSPNSF Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSF 33 >dbj|BAJ34536.1| unnamed protein product [Thellungiella halophila] Length = 84 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 437 MVLSNDIDLLNPPADLEKRRHKLKRLVQSPNSF 339 MVL NDIDLLNPPA+LEKR+HKLKRLVQSPNSF Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSF 33 >gb|ADN33695.1| 40S ribosomal protein s27 [Cucumis melo subsp. melo] Length = 86 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 437 MVLSNDIDLLNPPADLEKRRHKLKRLVQSPNSF 339 MVL NDIDLLNPPA+LEKR+HKLKRLVQSPNSF Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSF 33 >ref|XP_002880192.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297326031|gb|EFH56451.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 86 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 437 MVLSNDIDLLNPPADLEKRRHKLKRLVQSPNSF 339 MVL NDIDLLNPPA+LEKR+HKLKRLVQSPNSF Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSF 33