BLASTX nr result
ID: Papaver23_contig00000979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00000979 (567 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001240176.1| uncharacterized protein LOC100802918 [Glycin... 117 2e-24 gb|ABJ74185.1| putative ribosomal protein [Artemisia annua] 117 2e-24 gb|AAM63791.1| 40S ribosomal protein S19-like [Arabidopsis thali... 117 2e-24 ref|NP_198158.1| 40S ribosomal protein S24-2 [Arabidopsis thalia... 117 2e-24 ref|NP_187143.1| 40S ribosomal protein S24-1 [Arabidopsis thalia... 116 3e-24 >ref|NP_001240176.1| uncharacterized protein LOC100802918 [Glycine max] gi|255637268|gb|ACU18964.1| unknown [Glycine max] Length = 137 Score = 117 bits (292), Expect = 2e-24 Identities = 53/59 (89%), Positives = 59/59 (100%) Frame = -3 Query: 565 FRTHFGGGKSTGFGLIYDTVDNAKKFEPKYRLVRNGLDTKIERSRKQIKERKNRAKKIR 389 FRTHFGGGKSTGFGLIYDTV+NAKK+EPKYRL+RNGLDTK+E+SRKQ+KERKNRAKKIR Sbjct: 62 FRTHFGGGKSTGFGLIYDTVENAKKYEPKYRLIRNGLDTKVEKSRKQMKERKNRAKKIR 120 >gb|ABJ74185.1| putative ribosomal protein [Artemisia annua] Length = 102 Score = 117 bits (292), Expect = 2e-24 Identities = 53/59 (89%), Positives = 59/59 (100%) Frame = -3 Query: 565 FRTHFGGGKSTGFGLIYDTVDNAKKFEPKYRLVRNGLDTKIERSRKQIKERKNRAKKIR 389 FRTHFGGGKSTGFGLIYD+V+NAKK+EPKYRL+RNGLDTK+ERSRKQ+KERKNRAKKIR Sbjct: 29 FRTHFGGGKSTGFGLIYDSVENAKKYEPKYRLIRNGLDTKVERSRKQLKERKNRAKKIR 87 >gb|AAM63791.1| 40S ribosomal protein S19-like [Arabidopsis thaliana] Length = 133 Score = 117 bits (292), Expect = 2e-24 Identities = 54/59 (91%), Positives = 59/59 (100%) Frame = -3 Query: 565 FRTHFGGGKSTGFGLIYDTVDNAKKFEPKYRLVRNGLDTKIERSRKQIKERKNRAKKIR 389 FRTHFGGGKS+G+GLIYDTV+NAKKFEPKYRL+RNGLDTKIE+SRKQIKERKNRAKKIR Sbjct: 62 FRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120 >ref|NP_198158.1| 40S ribosomal protein S24-2 [Arabidopsis thaliana] gi|115502823|sp|Q8LC83.2|RS242_ARATH RecName: Full=40S ribosomal protein S24-2 gi|14423510|gb|AAK62437.1|AF386992_1 Unknown protein [Arabidopsis thaliana] gi|18377454|gb|AAL66893.1| unknown protein [Arabidopsis thaliana] gi|332006388|gb|AED93771.1| 40S ribosomal protein S24-2 [Arabidopsis thaliana] Length = 133 Score = 117 bits (292), Expect = 2e-24 Identities = 54/59 (91%), Positives = 59/59 (100%) Frame = -3 Query: 565 FRTHFGGGKSTGFGLIYDTVDNAKKFEPKYRLVRNGLDTKIERSRKQIKERKNRAKKIR 389 FRTHFGGGKS+G+GLIYDTV+NAKKFEPKYRL+RNGLDTKIE+SRKQIKERKNRAKKIR Sbjct: 62 FRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120 >ref|NP_187143.1| 40S ribosomal protein S24-1 [Arabidopsis thaliana] gi|11134742|sp|Q9SS17.1|RS241_ARATH RecName: Full=40S ribosomal protein S24-1 gi|12322851|gb|AAG51413.1|AC009465_13 putative ribosomal protein s19 or s24; 43956-42880 [Arabidopsis thaliana] gi|15215672|gb|AAK91381.1| AT3g04920/T9J14_13 [Arabidopsis thaliana] gi|17065190|gb|AAL32749.1| putative ribosomal protein [Arabidopsis thaliana] gi|20259968|gb|AAM13331.1| putative ribosomal protein s19 or s24 [Arabidopsis thaliana] gi|20334888|gb|AAM16200.1| AT3g04920/T9J14_13 [Arabidopsis thaliana] gi|21554374|gb|AAM63481.1| putative ribosomal protein s19 or s24 [Arabidopsis thaliana] gi|332640637|gb|AEE74158.1| 40S ribosomal protein S24-1 [Arabidopsis thaliana] Length = 133 Score = 116 bits (290), Expect = 3e-24 Identities = 54/59 (91%), Positives = 59/59 (100%) Frame = -3 Query: 565 FRTHFGGGKSTGFGLIYDTVDNAKKFEPKYRLVRNGLDTKIERSRKQIKERKNRAKKIR 389 FRTHFGGGKS+GFGLIYDTV++AKKFEPKYRL+RNGLDTKIE+SRKQIKERKNRAKKIR Sbjct: 62 FRTHFGGGKSSGFGLIYDTVESAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120