BLASTX nr result
ID: Papaver23_contig00000127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00000127 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX71676.1| 60S ribosomal protein L6-like protein [Panax quin... 76 3e-12 emb|CBI30046.3| unnamed protein product [Vitis vinifera] 76 3e-12 ref|XP_002278032.1| PREDICTED: 60S ribosomal protein L6 [Vitis v... 76 3e-12 sp|P34091.1|RL6_MESCR RecName: Full=60S ribosomal protein L6; Al... 76 3e-12 ref|XP_002513192.1| 60S ribosomal protein L6, putative [Ricinus ... 75 6e-12 >gb|ABX71676.1| 60S ribosomal protein L6-like protein [Panax quinquefolius] Length = 233 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 283 FYPADDVKKPLVNKRKAKPTKLRASITPGTVLIILAGR 396 FYPADDVKKPLVNKRK KPTKLRASITPGTVLIILAGR Sbjct: 64 FYPADDVKKPLVNKRKEKPTKLRASITPGTVLIILAGR 101 >emb|CBI30046.3| unnamed protein product [Vitis vinifera] Length = 205 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 283 FYPADDVKKPLVNKRKAKPTKLRASITPGTVLIILAGR 396 FYPADDVKKPL+NK KAKPTKLRASITPGTVLIILAGR Sbjct: 37 FYPADDVKKPLINKHKAKPTKLRASITPGTVLIILAGR 74 >ref|XP_002278032.1| PREDICTED: 60S ribosomal protein L6 [Vitis vinifera] Length = 231 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 283 FYPADDVKKPLVNKRKAKPTKLRASITPGTVLIILAGR 396 FYPADDVKKPL+NK KAKPTKLRASITPGTVLIILAGR Sbjct: 63 FYPADDVKKPLINKHKAKPTKLRASITPGTVLIILAGR 100 >sp|P34091.1|RL6_MESCR RecName: Full=60S ribosomal protein L6; AltName: Full=YL16-like gi|19539|emb|CAA49175.1| ribosomal protein YL16 [Mesembryanthemum crystallinum] Length = 234 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 283 FYPADDVKKPLVNKRKAKPTKLRASITPGTVLIILAGR 396 FYPADDVKKPL+NKRK KPTKLRASITPGTVLIILAGR Sbjct: 65 FYPADDVKKPLINKRKPKPTKLRASITPGTVLIILAGR 102 >ref|XP_002513192.1| 60S ribosomal protein L6, putative [Ricinus communis] gi|223547690|gb|EEF49183.1| 60S ribosomal protein L6, putative [Ricinus communis] Length = 233 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 283 FYPADDVKKPLVNKRKAKPTKLRASITPGTVLIILAGR 396 FYPADDVKKPL+NKRK KPTKLRASITPGTVLIILAGR Sbjct: 64 FYPADDVKKPLLNKRKPKPTKLRASITPGTVLIILAGR 101