BLASTX nr result
ID: Papaver22_contig00037463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00037463 (808 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_13502351.1| clumping factor A [Staphylococcus aureus subs... 59 1e-06 ref|YP_005297221.1| Clumping factor ClfA, fibrinogen-binding pro... 59 1e-06 gb|ADW82868.1| clumping factor A [Staphylococcus aureus] gi|3214... 59 1e-06 ref|ZP_12548874.1| clumping factor A, partial [Staphylococcus au... 59 1e-06 ref|YP_006194942.1| Clumping factor A [Staphylococcus aureus sub... 57 4e-06 >ref|ZP_13502351.1| clumping factor A [Staphylococcus aureus subsp. aureus IS-160] gi|375377627|gb|EHS81079.1| clumping factor A [Staphylococcus aureus subsp. aureus IS-160] Length = 959 Score = 59.3 bits (142), Expect = 1e-06 Identities = 60/233 (25%), Positives = 103/233 (44%) Frame = +1 Query: 55 NESTSNSNPRSNKEEKSSCAKDIESDIGSIQKTRVGLDRREDIFEVNGVVSATSNSNLKP 234 N+S S+S+ S+ + S D +SD S + D D + + + S+S+L Sbjct: 652 NDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDLDS 710 Query: 235 NRDENSDCIKDDKLDTGAITCVGHDCKEISEVNGNVSPSDSNPRSNIEENSSCVKDMKFD 414 + D +SD D D+ + + D S+ + + S SDS+ S+ + +S D D Sbjct: 711 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSD 769 Query: 415 MGSVQKNRIGLNRGKDIFEVSDVVCASSSDRRKDIFKVNDVVCGTSSSNLKSNFDCIKDD 594 S + + D SD S SD D +D S SN +S+ D D Sbjct: 770 SASDSDSDSDSDSDSDSDSDSDSESDSDSDSVSDSDSDSD---SDSDSNSESDSDSDSDS 826 Query: 595 KSDTGAVTCVGNDCKEIVEANGNVGTSDSNPRSNEEGNSNHVKDNKSDTGAIN 753 SD+ + + G+D +++ + SDS+ S+ + S+ D+ SDTG+ N Sbjct: 827 DSDSASDSDSGSDSDSDSDSDSD---SDSDSDSDSDSTSDSDSDSTSDTGSDN 876 >ref|YP_005297221.1| Clumping factor ClfA, fibrinogen-binding protein [Staphylococcus aureus subsp. aureus M013] gi|359829868|gb|AEV77846.1| Clumping factor ClfA, fibrinogen-binding protein [Staphylococcus aureus subsp. aureus M013] Length = 938 Score = 59.3 bits (142), Expect = 1e-06 Identities = 60/233 (25%), Positives = 103/233 (44%) Frame = +1 Query: 55 NESTSNSNPRSNKEEKSSCAKDIESDIGSIQKTRVGLDRREDIFEVNGVVSATSNSNLKP 234 N+S S+S+ S+ + S D +SD S + D D + + + S+S+L Sbjct: 632 NDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDLDS 690 Query: 235 NRDENSDCIKDDKLDTGAITCVGHDCKEISEVNGNVSPSDSNPRSNIEENSSCVKDMKFD 414 + D +SD D D+ + + D S+ + + S SDS+ S+ + +S D D Sbjct: 691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSD 749 Query: 415 MGSVQKNRIGLNRGKDIFEVSDVVCASSSDRRKDIFKVNDVVCGTSSSNLKSNFDCIKDD 594 S + + D SD S SD D +D S SN +S+ D D Sbjct: 750 SASDSDSDSDSDSDSDSDSDSDSESDSDSDSVSDSDSDSD---SDSDSNSESDSDSDSDS 806 Query: 595 KSDTGAVTCVGNDCKEIVEANGNVGTSDSNPRSNEEGNSNHVKDNKSDTGAIN 753 SD+ + + G+D +++ + SDS+ S+ + S+ D+ SDTG+ N Sbjct: 807 DSDSASDSDSGSDSDSDSDSDSD---SDSDSDSDSDSTSDSDSDSTSDTGSDN 856 >gb|ADW82868.1| clumping factor A [Staphylococcus aureus] gi|321400929|gb|ADW82883.1| clumping factor A [Staphylococcus aureus] Length = 404 Score = 59.3 bits (142), Expect = 1e-06 Identities = 60/233 (25%), Positives = 103/233 (44%) Frame = +1 Query: 55 NESTSNSNPRSNKEEKSSCAKDIESDIGSIQKTRVGLDRREDIFEVNGVVSATSNSNLKP 234 N+S S+S+ S+ + S D +SD S + D D + + + S+S+L Sbjct: 161 NDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDLDS 219 Query: 235 NRDENSDCIKDDKLDTGAITCVGHDCKEISEVNGNVSPSDSNPRSNIEENSSCVKDMKFD 414 + D +SD D D+ + + D S+ + + S SDS+ S+ + +S D D Sbjct: 220 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSD 278 Query: 415 MGSVQKNRIGLNRGKDIFEVSDVVCASSSDRRKDIFKVNDVVCGTSSSNLKSNFDCIKDD 594 S + + D SD S SD D +D S SN +S+ D D Sbjct: 279 SASDSDSDSDSDSDSDSDSDSDSESDSDSDSVSDSDSDSD---SDSDSNSESDSDSDSDS 335 Query: 595 KSDTGAVTCVGNDCKEIVEANGNVGTSDSNPRSNEEGNSNHVKDNKSDTGAIN 753 SD+ + + G+D +++ + SDS+ S+ + S+ D+ SDTG+ N Sbjct: 336 DSDSASDSDSGSDSDSDSDSDSD---SDSDSDSDSDSTSDSDSDSTSDTGSDN 385 >ref|ZP_12548874.1| clumping factor A, partial [Staphylococcus aureus subsp. aureus 21269] gi|341844697|gb|EGS85905.1| clumping factor A [Staphylococcus aureus subsp. aureus 21269] Length = 333 Score = 58.9 bits (141), Expect = 1e-06 Identities = 63/245 (25%), Positives = 102/245 (41%), Gaps = 14/245 (5%) Frame = +1 Query: 55 NESTSNSNPRSNKEEKSSCAKDIESDIGSIQKTRVGLDRREDIFEVNGVVSATSNSNLKP 234 ++S S+S+ S+ + S A D +SD+ S + D D + S+S+ Sbjct: 64 SDSDSDSDSDSDSDSDSDSASDSDSDLDSDSDSDSDSDSDSDS-------DSASDSDSDS 116 Query: 235 NRDENSDCIKDDKLDTGAITCVGHDCKEISEVNGNV---SPSDSNPRSNIEENSSCVKDM 405 + D +SD D D+ + + G D S+ + N S SDS+ ++ + +S Sbjct: 117 DSDSDSDSASDSDSDSASDSDSGSDSDSSSDSDSNSASDSDSDSDSANDSDSDSDSDSAS 176 Query: 406 KFDMGSVQKNRIGLNRGKDIFEVSDVVCASSSDRRKDIFKVNDVVCGTSSSNLKSNFDCI 585 D GS + + D SD AS SD D +D S S+ S+ D Sbjct: 177 DSDSGSDSDSASDSDSDSDSDSDSDSDSASDSDSNSDSDSDSDSD-SDSDSDSDSDSDSA 235 Query: 586 KDDKSDTGAVTCVGNDCKEIVEANGNVGTSDSN----PRSNEEG----NSNHVKDNKS-- 735 D SD+ + T ND ++N + + +N P S + G N N KD+K Sbjct: 236 SDSDSDSTSDTGSDNDSDSESDSNSDSDSGSNNNVVPPNSPKNGTNASNKNEAKDSKEPL 295 Query: 736 -DTGA 747 DTG+ Sbjct: 296 PDTGS 300 >ref|YP_006194942.1| Clumping factor A [Staphylococcus aureus subsp. aureus 71193] gi|384229852|gb|AFH69099.1| Clumping factor A [Staphylococcus aureus subsp. aureus 71193] Length = 975 Score = 57.4 bits (137), Expect = 4e-06 Identities = 63/237 (26%), Positives = 99/237 (41%), Gaps = 4/237 (1%) Frame = +1 Query: 55 NESTSNSNPRSNKEEKSSCAKDIESDIGSIQKTRVGLDRREDI-FEVNGVVSATSNSNLK 231 ++S S+S+ S+ + S D +SD S + D D E + + S+S+ Sbjct: 703 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSESESDSDSDSDSDSDSD 762 Query: 232 PNRDENSDCIKDDKLDTGAITCVGHDCKEISEVNGNVSPSDSNPRSNIEENSSCVKDMKF 411 + D +SD D D+ + + D S+ S SDS+ S+ + +S D Sbjct: 763 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSASD-----SDSDSDSDSDSDSDSDSDSDNDS 817 Query: 412 DMGSVQKNRIGLNRGKDIFEVSDVVCASSSDRRKDIFKVNDVVCGT-SSSNLKSNFDCIK 588 D S + + G D SD S+SD D +D G+ S S+ S+ D Sbjct: 818 DSDSDSDSASDSDSGSDSDSSSDSDSDSASDSDSDSDSASDSDSGSDSDSSSDSDSDSAS 877 Query: 589 DDKSDTGAVTCVGNDCKEIVEANGNVGTSDSNPRSNEEGNSNHVKDN--KSDTGAIN 753 D SD+ + + G+D N + SDSN S N+N V N K+ T A N Sbjct: 878 DSDSDSDSTSDTGSD-------NDSDSESDSNSDSESGSNNNVVPPNSPKNGTNASN 927