BLASTX nr result
ID: Papaver22_contig00036946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00036946 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518981.1| conserved hypothetical protein [Ricinus comm... 80 4e-16 ref|XP_003628114.1| hypothetical protein MTR_8g043760 [Medicago ... 86 3e-15 ref|XP_004163046.1| PREDICTED: uncharacterized LOC101204643 [Cuc... 85 5e-15 ref|XP_004148660.1| PREDICTED: uncharacterized protein LOC101204... 85 5e-15 ref|NP_176256.2| SWIM zinc finger-like protein [Arabidopsis thal... 85 5e-15 >ref|XP_002518981.1| conserved hypothetical protein [Ricinus communis] gi|223541968|gb|EEF43514.1| conserved hypothetical protein [Ricinus communis] Length = 719 Score = 80.5 bits (197), Expect(3) = 4e-16 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +1 Query: 253 RKRTRGSLTSYNSDEYLSVACRYWCLFGPESYGDGGEILPSRRYRINTRNRA 408 RKR+RGSL Y +DEYL YWC FGPE+YG+GG+ LPSRRYR+NTRNRA Sbjct: 70 RKRSRGSLKEYKNDEYLEYKL-YWCSFGPENYGEGGDTLPSRRYRLNTRNRA 120 Score = 27.3 bits (59), Expect(3) = 4e-16 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = +3 Query: 123 MEMIESIEDIKLQDLP-EEFTPADL 194 M+++ESI DI +Q+ P EEF+ ADL Sbjct: 1 MDIVESIFDIPVQNPPDEEFSSADL 25 Score = 21.2 bits (43), Expect(3) = 4e-16 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 212 SEQECLARFHIKKEENVPEG 271 S EC RFHI+++ G Sbjct: 56 SNVECPTRFHIERQRKRSRG 75 >ref|XP_003628114.1| hypothetical protein MTR_8g043760 [Medicago truncatula] gi|355522136|gb|AET02590.1| hypothetical protein MTR_8g043760 [Medicago truncatula] Length = 732 Score = 85.9 bits (211), Expect(2) = 3e-15 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = +1 Query: 247 KGRKRTRGSLTSYNSDEYLSVACRYWCLFGPESYGDGGEILPSRRYRINTRNRAA 411 +GRKRT G+L Y DEYL +YWC FGPE+YG+GGEILPSRRYR+NTRNRAA Sbjct: 70 RGRKRTIGTLKEYKDDEYLEYR-QYWCSFGPENYGEGGEILPSRRYRLNTRNRAA 123 Score = 20.4 bits (41), Expect(2) = 3e-15 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 422 KRLYARPS 445 KRLYARPS Sbjct: 138 KRLYARPS 145 >ref|XP_004163046.1| PREDICTED: uncharacterized LOC101204643 [Cucumis sativus] Length = 718 Score = 85.1 bits (209), Expect(2) = 5e-15 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +1 Query: 247 KGRKRTRGSLTSYNSDEYLSVACRYWCLFGPESYGDGGEILPSRRYRINTRNRAA 411 +GRKR+RGSL + DEYL +YWC FGPE+YG+GG ILPSRRYR+NTRNRAA Sbjct: 68 RGRKRSRGSLKEFKDDEYLEYR-QYWCSFGPENYGEGGSILPSRRYRLNTRNRAA 121 Score = 20.4 bits (41), Expect(2) = 5e-15 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 422 KRLYARPS 445 KRLYARPS Sbjct: 136 KRLYARPS 143 >ref|XP_004148660.1| PREDICTED: uncharacterized protein LOC101204643 [Cucumis sativus] Length = 718 Score = 85.1 bits (209), Expect(2) = 5e-15 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +1 Query: 247 KGRKRTRGSLTSYNSDEYLSVACRYWCLFGPESYGDGGEILPSRRYRINTRNRAA 411 +GRKR+RGSL + DEYL +YWC FGPE+YG+GG ILPSRRYR+NTRNRAA Sbjct: 68 RGRKRSRGSLKEFKDDEYLEYR-QYWCSFGPENYGEGGSILPSRRYRLNTRNRAA 121 Score = 20.4 bits (41), Expect(2) = 5e-15 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 422 KRLYARPS 445 KRLYARPS Sbjct: 136 KRLYARPS 143 >ref|NP_176256.2| SWIM zinc finger-like protein [Arabidopsis thaliana] gi|19715655|gb|AAL91647.1| At1g60560/F8A5_10 [Arabidopsis thaliana] gi|27363242|gb|AAO11540.1| At1g60560/F8A5_10 [Arabidopsis thaliana] gi|332195577|gb|AEE33698.1| SWIM zinc finger-like protein [Arabidopsis thaliana] Length = 703 Score = 85.1 bits (209), Expect(2) = 5e-15 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +1 Query: 247 KGRKRTRGSLTSYNSDEYLSVACRYWCLFGPESYGDGGEILPSRRYRINTRNRAA 411 +GRKR+RGSL Y SDEYL YWC FGPE+YG+GG +LPSR+YR+NTRNRAA Sbjct: 68 RGRKRSRGSLKEYKSDEYLEYRL-YWCSFGPENYGEGGGVLPSRKYRLNTRNRAA 121 Score = 20.4 bits (41), Expect(2) = 5e-15 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 422 KRLYARPS 445 KRLYARPS Sbjct: 136 KRLYARPS 143