BLASTX nr result
ID: Papaver22_contig00036945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00036945 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157704.1| PREDICTED: cysteine-rich repeat secretory pr... 65 9e-09 ref|XP_004157649.1| PREDICTED: cysteine-rich repeat secretory pr... 65 9e-09 ref|XP_004134041.1| PREDICTED: cysteine-rich repeat secretory pr... 65 9e-09 ref|XP_002285462.1| PREDICTED: cysteine-rich repeat secretory pr... 65 1e-08 ref|XP_002528357.1| DUF26 domain-containing protein 2 precursor,... 65 1e-08 >ref|XP_004157704.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 274 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 605 VQNAQNQCGGAISGQIYLHKCYISYSYYPNGVPTK 501 VQ AQ +CG +ISGQ+YLH+C+ISYSYYPNGVPT+ Sbjct: 217 VQRAQVECGSSISGQLYLHRCFISYSYYPNGVPTR 251 >ref|XP_004157649.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 301 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 605 VQNAQNQCGGAISGQIYLHKCYISYSYYPNGVPTK 501 VQ AQ +CG +ISGQ+YLH+C+ISYSYYPNGVPT+ Sbjct: 217 VQRAQVECGSSISGQLYLHRCFISYSYYPNGVPTR 251 >ref|XP_004134041.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 301 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 605 VQNAQNQCGGAISGQIYLHKCYISYSYYPNGVPTK 501 VQ AQ +CG +ISGQ+YLH+C+ISYSYYPNGVPT+ Sbjct: 217 VQRAQVECGSSISGQLYLHRCFISYSYYPNGVPTR 251 >ref|XP_002285462.1| PREDICTED: cysteine-rich repeat secretory protein 3 [Vitis vinifera] gi|296083727|emb|CBI23716.3| unnamed protein product [Vitis vinifera] Length = 295 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 605 VQNAQNQCGGAISGQIYLHKCYISYSYYPNGVPTK 501 VQ AQ +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 210 VQRAQVECGSSISGQIYLHKCFISYSYYPNGVPRR 244 >ref|XP_002528357.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus communis] gi|223532225|gb|EEF34029.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus communis] Length = 296 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 605 VQNAQNQCGGAISGQIYLHKCYISYSYYPNGVPTK 501 VQ AQ +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 210 VQRAQVECGNSISGQIYLHKCFISYSYYPNGVPRR 244