BLASTX nr result
ID: Papaver22_contig00036876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00036876 (837 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-... 52 9e-06 >gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana] Length = 1142 Score = 52.4 bits (124), Expect(2) = 9e-06 Identities = 26/62 (41%), Positives = 37/62 (59%) Frame = +3 Query: 393 ERGLSQGNPIFPYPYFICTEALSAYISKLKRTYLVHGVKIAIVAGLLLTYCFAYESFIIT 572 ERGL QG+P+ PY + +CTE L A I K +R L+ G+K+A + + FA +S Sbjct: 414 ERGLRQGDPLSPYLFILCTEVLIANIRKAERQNLITGIKVATPSPAVSHLLFADDSLFFC 473 Query: 573 KA 578 KA Sbjct: 474 KA 475 Score = 23.5 bits (49), Expect(2) = 9e-06 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 329 CLNSVIYSVLLNGSP 373 C+ +V Y VL+NG P Sbjct: 393 CITTVQYKVLINGQP 407