BLASTX nr result
ID: Papaver22_contig00036660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00036660 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Vitis vinifera] Length = 582 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 461 GKLLDARDILVCMIEKGLKPNFPVYVKVSKDLYKAGMSHLSADLKSRFSKLN 306 G L+ A+ IL+ MIEKGLKPNF VY +V + L K+G L+ DL+SRFS L+ Sbjct: 523 GNLISAQKILIEMIEKGLKPNFSVYKRVLEHLDKSGREDLAGDLRSRFSSLS 574