BLASTX nr result
ID: Papaver22_contig00036234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00036234 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_194638.1| Ribonuclease H-like protein [Arabidopsis thalia... 60 1e-07 >ref|NP_194638.1| Ribonuclease H-like protein [Arabidopsis thaliana] gi|4972055|emb|CAB43923.1| putative protein [Arabidopsis thaliana] gi|7269807|emb|CAB79667.1| putative protein [Arabidopsis thaliana] gi|67633766|gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis thaliana] gi|332660185|gb|AEE85585.1| Ribonuclease H-like protein [Arabidopsis thaliana] Length = 575 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/115 (27%), Positives = 54/115 (46%) Frame = +2 Query: 68 WFVSISGVNDQLQRSIQLAGIVLWHIWKTRCQLVFDNLCIPVVTLSMQVKKFISDWDTNL 247 W ++ N Q +++ QL +LW +WK R +LVF + + + + +W Sbjct: 342 WVFNLGNGNPQWEKASQLVPWLLWRLWKNRNELVFRGREFNAQEVLRRAEDDLEEWRIRT 401 Query: 248 TTMSINGQNVQGRADRSSRWIVPTNPFVKINFDASFKTDCNKCGLGLIMRSFAGE 412 S G Q RW P + +VK N DA++ D +CG+G ++R+ GE Sbjct: 402 EAESC-GTKPQVNRSSCGRWRPPPHQWVKCNTDATWNRDNERCGIGWVLRNEKGE 455