BLASTX nr result
ID: Papaver22_contig00036134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00036134 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002846269.1| ATP-dependent DNA helicase PIF1 [Arthroderma... 58 9e-07 >ref|XP_002846269.1| ATP-dependent DNA helicase PIF1 [Arthroderma otae CBS 113480] gi|238841525|gb|EEQ31187.1| ATP-dependent DNA helicase PIF1 [Arthroderma otae CBS 113480] Length = 1114 Score = 57.8 bits (138), Expect = 9e-07 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = -3 Query: 447 VVSWFFQKRVDVXXXXXXXXXFPLVDHWYRFEWQNRGSGHVHGFLWFKDRP 295 + S + +KR + F ++DHW+R++WQ+RGSGH+H FLW +D P Sbjct: 124 IASAYLEKRFNTFFKCVLKPKFKVIDHWFRYKWQSRGSGHIHSFLWCEDTP 174