BLASTX nr result
ID: Papaver22_contig00035993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00035993 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-... 55 6e-06 >ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 23-like [Glycine max] Length = 621 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +2 Query: 92 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDI 208 ANSRI+R FMEV PP++V ++R+R SK LDTI E+E++I Sbjct: 2 ANSRIARFFMEVAPPQYVTVMRHRTSKMLDTITEDEREI 40