BLASTX nr result
ID: Papaver22_contig00035477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00035477 (554 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277637.1| PREDICTED: uncharacterized protein LOC100267... 58 9e-07 ref|XP_002521377.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002277637.1| PREDICTED: uncharacterized protein LOC100267009 [Vitis vinifera] Length = 117 Score = 58.2 bits (139), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 326 FNDPELQRKKRVASYKVYAA*GKMKGSFRRN 418 FNDPELQRKKRVASYKVYA GKMKGSFR++ Sbjct: 71 FNDPELQRKKRVASYKVYAVEGKMKGSFRKS 101 >ref|XP_002521377.1| conserved hypothetical protein [Ricinus communis] gi|223539455|gb|EEF41045.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 326 FNDPELQRKKRVASYKVYAA*GKMKGSFRRN 418 FNDPELQRKKRVASYKVYA GKMKGS R++ Sbjct: 73 FNDPELQRKKRVASYKVYAMEGKMKGSLRKS 103