BLASTX nr result
ID: Papaver22_contig00034622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00034622 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634651.1| PREDICTED: receptor-like protein kinase THES... 68 9e-10 ref|XP_004154820.1| PREDICTED: LOW QUALITY PROTEIN: receptor-lik... 67 1e-09 ref|XP_004150104.1| PREDICTED: receptor-like protein kinase THES... 67 1e-09 ref|XP_002533716.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 ref|XP_002316926.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 >ref|XP_003634651.1| PREDICTED: receptor-like protein kinase THESEUS 1-like [Vitis vinifera] Length = 843 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 473 DNSVSMIDGVTSGTDDDAEDVATSAVFSQLVNPRGR 366 +NSVSMIDGV SGTDDDAED ATSAVFSQLVNPRGR Sbjct: 808 ENSVSMIDGVHSGTDDDAEDAATSAVFSQLVNPRGR 843 >ref|XP_004154820.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase THESEUS 1-like [Cucumis sativus] Length = 839 Score = 67.4 bits (163), Expect = 1e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 473 DNSVSMIDGVTSGTDDDAEDVATSAVFSQLVNPRGR 366 DNSVSMIDG SGTDDDAED ATSAVFSQLVNPRGR Sbjct: 804 DNSVSMIDGGNSGTDDDAEDAATSAVFSQLVNPRGR 839 >ref|XP_004150104.1| PREDICTED: receptor-like protein kinase THESEUS 1-like [Cucumis sativus] Length = 839 Score = 67.4 bits (163), Expect = 1e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 473 DNSVSMIDGVTSGTDDDAEDVATSAVFSQLVNPRGR 366 DNSVSMIDG SGTDDDAED ATSAVFSQLVNPRGR Sbjct: 804 DNSVSMIDGGNSGTDDDAEDAATSAVFSQLVNPRGR 839 >ref|XP_002533716.1| conserved hypothetical protein [Ricinus communis] gi|223526390|gb|EEF28679.1| conserved hypothetical protein [Ricinus communis] Length = 125 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 473 DNSVSMIDGVTSGTDDDAEDVATSAVFSQLVNPRGR 366 DNSVS+IDG SGTDDDAED ATSAVFSQLVNPRGR Sbjct: 90 DNSVSIIDGGNSGTDDDAEDAATSAVFSQLVNPRGR 125 >ref|XP_002316926.1| predicted protein [Populus trichocarpa] gi|222859991|gb|EEE97538.1| predicted protein [Populus trichocarpa] Length = 847 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 473 DNSVSMIDGVTSGTDDDAEDVATSAVFSQLVNPRGR 366 DNS S+IDG SGT+DDAEDVATSAVFSQLVNPRGR Sbjct: 812 DNSTSIIDGGNSGTEDDAEDVATSAVFSQLVNPRGR 847