BLASTX nr result
ID: Papaver22_contig00034424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00034424 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa ... 46 6e-06 >gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa rugosa] Length = 1656 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 2/99 (2%) Frame = -1 Query: 351 LPFLGSDHCPIFLDLSPNKVSSSRNWKLFQCWLRENSCKEQNLNAWSKPVNGSAAYVLDR 172 LP +GSDH P+ LD +P ++ +R ++ Q W + +W GSA +R Sbjct: 822 LPKIGSDHRPLLLDSNPKMLNKTRLFRFEQMWTTHEEYSDVIQRSWPPAFGGSAMRSWNR 881 Query: 171 KLSETRCTLSRWNKKLLG--IYKATSNLYNMTCQHSSNP 61 L L W+K+ + L ++ H SNP Sbjct: 882 NLLSCGKALKMWSKEKFSNPSVQVADLLSDIEKLHQSNP 920 Score = 28.9 bits (63), Expect(2) = 6e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 439 WTSNRYGTGKIRTRLERALINVDWSLS 359 W + R+G I+ RL+RAL N+ WS S Sbjct: 787 WFAMRHGRVFIKERLDRALGNIAWSSS 813